KEGG   Monodelphis domestica (opossum): 100015889Help
Entry
100015889         CDS       T01031                                 

Definition
alcohol dehydrogenase E chain-like
Orthology
K13951  
alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Metabolic pathways
Chemical carcinogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mdo00010]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:mdo00071]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:mdo00350]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:mdo00830]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:mdo00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:mdo00982]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:mdo05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
5
AA seq 375 aa AA seqDB search
MSTAGKVIKCKAAVLWELNKPFSIEEVEVAPPKANEVRIKIIATGICRSDDHVVAGLLAY
PVPIILGHEAAGIVESVGEGVTSVKPGDKVIPLFTPQCRQCTVCKHPVGNLCKGNALNHR
DVTLKEGTTRFTCRGKPINHFLSTSTFSEYTVVDEISVVKIDSSAPLEKVCLVGCGFSTG
YGSAVKVAKVTPGSTCVVFGLGGVGLSVVIGCKAAGASRIIGVDINKDKFAKAKEVGATE
CVNPLDYKKPIQDVLIEMTDNTIDFSFEVIGRLDTVTAALLSCNDAYGVCVIVGVPPGSQ
TISIDPLLLLTGRTWKGAVFGGFKSKDDVPKIVSDVLSKKFNLDPLITHVYNFDKINEGF
DLLRSGKSIRTVLKM
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtccacagcaggaaaagtcattaaatgcaaagccgctgttctttgggagttgaacaag
cccttttccattgaagaagtagaagttgccccacccaaggccaatgaagttcgtattaag
attattgcaacaggaatctgccgctcagatgaccatgtggtagctggattattagcatac
ccagtcccaataatcctggggcatgaggctgcagggattgtggagagcgttggagaagga
gtgacttctgtgaaaccaggtgacaaagtcattccactctttactccacagtgcagacaa
tgcacagtttgtaagcacccggttggcaacttatgcaaaggaaatgcactgaatcaccgt
gatgtcaccttaaaggaaggtaccaccagatttacctgccgaggaaagccaattaatcat
tttcttagcacaagcaccttttctgagtatacagtggtagatgaaatctcagtcgtaaag
atcgattcatccgctcctctggaaaaagtttgcttggttggctgtggattttccactggt
tatggttctgcagtaaaggttgccaaggtcacccctggatctacttgtgttgtctttggc
ctgggaggcgttggcttgtcagtagtcataggctgcaaggcagctggagcctcccggatc
attggggtagacatcaacaaggacaaatttgcaaaggccaaagaggtaggtgctactgag
tgtgtcaaccctctggactacaagaaacccattcaagatgttctgattgaaatgaccgac
aataccattgatttttcattcgaagttattggacgcctggacacagtgacagctgcccta
ttatcctgcaatgatgcttatggagtttgtgtcattgtgggcgttcctcctggttcccaa
actatttctatcgaccctctgctacttttgactggacgcacctggaaaggagctgttttt
ggaggttttaaaagcaaagatgatgtccccaagatagtctctgatgttttaagcaagaaa
tttaacttggatccattaataacacatgtttataattttgataagatcaatgaaggattt
gatctgctacgctcaggaaagagcattcgcacagttctgaaaatgtga

DBGET integrated database retrieval system