KEGG   Monodelphis domestica (opossum): 100016186Help
Entry
100016186         CDS       T01031                                 

Definition
cartilage oligomeric matrix protein-like
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:mdo04151]
Environmental Information Processing; Signaling molecules and interaction; ECM-receptor interaction [PATH:mdo04512]
Cellular Processes; Transport and catabolism; Phagosome [PATH:mdo04145]
Cellular Processes; Cell communication; Focal adhesion [PATH:mdo04510]
Human Diseases; Infectious diseases; Malaria [PATH:mdo05144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 762 aa AA seqDB search
MPLSPSLGLLLLAFACHLVTGQRQAPVGGDVAPQMLREMKETNLVLQEVRELLKQQIKEI
TFLKNTVMECDACGMQPVTSPWTSVRPLNRCEPDSCFPGVTCTETPGGGFRCGPCPPGYS
GNGSHCTDVNECNAHPCYPRVRCINTSPGFRCEACPPGYSGPVHEGVGLAFAKANKQVCT
DINECETGQHNCVPNSLCTNTRGSFQCGPCKPGFVGDQASGCRRRAQRMCPNGEPSPCHE
NADCILERDGSTSCVCAVGWAGNGLVCGKDTDLDGFPDEKLRCPDRKCRKDNCLKVPNSG
QEDVDKDGIGDACDPDADGDGVLNEQDNCVLVRNPDQRNSDGDKWGDACDNCRGEKNDDQ
RDTDRDGRGDACDDDIDGDRIRNALDNCPRVPNPDQRDSDRDGVGDACDNCPQKGNADQR
DVDHDLVGDACDSDQDQDGDGHQDSRDNCPTVPNSSQQDTDKDGQGDACDDDDDNDGIPD
HRAPGPDNCRLVPNPNQEDADGDGVGDACQDDFDADKVVDKIDVCPENAEVTLTDFRAFQ
TVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVDFEGTFHVNTLTDDD
YAGLIFGYQDSSSFYVVMWKQMEQTYWQANPFRAVAEPGIQLKAVKSSTGPGEQLRNALW
HTGDTTDQVKLLWKDPRNVGWKDKTSYRWFLQHRPQVGYIRVRFYEGPELVADSNVVLDT
TMRGGRLGVFCFSQENIIWANLRYRCNDTIPEDYEAYRLQQN
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atgcccttatccccctcgcttgggctgttgcttctcgccttcgcctgccacctcgtcacg
ggtcagagacaggcaccagtggggggagatgtggcgccccagatgctccgggagatgaag
gaaaccaatttggtgctgcaggaggtgcgggaactcctgaaacagcagatcaaagaaatc
acattcctgaagaataccgtgatggagtgtgatgcctgtggcatgcagcccgtgactagt
ccgtggacaagcgtgcggcctctgaatcgatgcgagccagactcctgcttcccaggggtc
acctgcaccgaaaccccagggggcggcttccgttgtgggccctgccctccaggctattcc
ggcaatggatcgcactgcaccgacgtgaacgagtgtaatgcacacccctgctatccccgg
gtccgctgcatcaacaccagcccaggattccgctgtgaagcctgccccccggggtacagt
gggcctgtccacgagggcgtgggcctggcttttgccaaagccaacaagcaggtttgcact
gacatcaatgagtgtgagacgggccagcacaactgtgttcccaactcgctgtgcaccaac
actcggggatccttccagtgtgggccctgcaagcccggttttgtaggggatcaagcctct
ggctgccggaggagggcccaacggatgtgtcctaatggggagcccagtccctgccatgaa
aatgccgactgcatcctggagagggacggctctacctcctgtgtgtgtgctgtgggctgg
gctggcaacgggctcgtgtgtggcaaggacacagatctggacggctttccggatgagaag
ctgcggtgccccgacaggaagtgccgaaaggataactgcctaaaggtgcccaactcgggc
caggaggatgttgacaaagatggcatcggggatgcttgtgatccagatgccgacggggac
ggagtgctcaatgagcaggataactgcgtcctggttcggaatccagaccagcggaatagt
gatggagacaaatggggcgacgcctgtgacaactgccgtggggagaagaacgacgaccag
agggatacggaccgggatggccgaggcgatgcctgcgacgacgacatcgatggggaccgg
atccggaatgctcttgacaactgtccgagggtccccaacccagaccaacgggacagtgac
agagatggggtaggagatgcctgtgataactgtccacaaaagggcaatgctgaccagaga
gatgtggatcacgatctagtaggggacgcctgtgacagtgaccaggaccaggacggtgac
gggcaccaggactctcgggacaactgccccaccgtgcccaatagctctcagcaggacacg
gataaggacgggcagggcgatgcctgtgatgacgatgatgacaacgatggaatcccagac
caccgtgccccggggccagacaactgtcgcctggtccccaaccccaatcaggaggatgcg
gacggcgatggggtaggtgatgcgtgccaggacgactttgatgcagacaaggttgtggac
aagatcgacgtgtgcccagagaacgcagaggtcaccctcacagacttccgagccttccag
actgttgttctggaccccgagggagatgcgcagatagaccccaattgggtggttctcaat
caggggatggagatcgtgcagacaatgaacagtgaccctggactggctgtgggctacaca
gcctttaatggcgtggacttcgaaggcacgttccacgtgaacaccctcaccgacgatgac
tatgctggtctcatctttggctaccaggacagctccagcttttacgtggtcatgtggaaa
cagatggaacagacatactggcaggcaaatcccttcagagctgtggctgaacctggcatt
cagctcaaggccgtgaagtcgtccacgggccccggagagcagctgcgcaatgccctgtgg
cacacaggggacaccaccgaccaggtgaagctgctctggaaagaccccagaaacgtgggc
tggaaggacaagacgtcttatcgctggttcctgcagcaccggccgcaagtgggctacatc
cgggtccgcttttacgaggggcccgagctcgtggccgacagtaacgtggtgctggacacg
accatgcgaggaggccgcctcggcgtcttctgcttctcccaggaaaacatcatttgggcc
aatctccgttaccgatgtaatgacaccattcccgaggactacgaggcctatcgtctgcaa
cagaactaa

DBGET integrated database retrieval system