KEGG   Monodelphis domestica (opossum): 100016231Help
Entry
100016231         CDS       T01031                                 

Gene name
ART5
Definition
ADP-ribosyltransferase 5
Orthology
K00775  
NAD(P)-arginine ADP-ribosyltransferase [EC:2.4.2.31]
Organism
mdo  Monodelphis domestica (opossum)
Brite
Enzymes [BR:mdo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     100016231 (ART5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 307 aa AA seqDB search
MLPTLMIALSCLGLSPLIQAQVIPIVPLGPAPNTFDDAYLDCEEQMEKEATHLLQEEMAR
HSLLRESWGAATVAWESRRKGLTLPMGFGTQHAVAIMVYTNSSNPLYQELNSAVRTAGSS
REDYMKHFPFKALHFYLMQALQLLRASKSCQGGLGQEVFRGVSTLRFQPHQLGDVIRLGQ
FTSTSEEKGVAQGFGNSTFFTMSTCFGVPIQAFSVFPEEREVLIPPHEVFLVSGFSHDGV
RNLVTIRSLNRTCSHFNCAYLGGEKKEGCVSNPGQSWDAFFPGSWPQLMPRTLLLPHGAF
QLSGPVP
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgctgcccaccctgatgattgcacttagctgtctgggcctcagccccctcatacaggcc
caagttatccccatcgtgcctttgggcccagctcctaacacctttgatgatgcctacttg
gactgtgaggagcagatggagaaggaggccacccacctgctccaggaggagatggcgcgc
cactccctgctccgggaatcttggggggctgccacagttgcctgggagagtcggaggaag
gggctcactctgcccatgggtttcggaacccagcatgctgtggctatcatggtctacact
aattcatccaaccccctgtaccaggagctgaactcggccgtgaggacggccggcagctct
cgggaggactacatgaagcacttccccttcaaggccctgcatttctacctgatgcaggcc
ctgcagctgctgagagcttcaaagagctgtcaggggggccttggacaggaagtgttccga
ggcgtgagcaccctccgcttccagcctcatcagctgggagatgtcattcgcctcggccag
ttcacttccacctcggaggagaaaggggtggcccagggatttgggaactcgaccttcttc
accatgagcacttgttttggagttcccatacaagccttttcagtcttccccgaagaacga
gaggtcctcatccctcctcatgaggttttcctggtgtctggcttctctcacgatggggtc
cggaacctggtgaccatcaggagtctcaatcggacctgcagccacttcaactgtgcctac
cttggaggagaaaagaaagaaggctgtgtatctaacccaggacaaagttgggatgctttc
ttcccaggatcttggcctcagctaatgccaaggactctgctcctgcctcatggggccttc
cagctctcaggtccagtgccctga

DBGET integrated database retrieval system