KEGG   Monodelphis domestica (opossum): 100016245Help
Entry
100016245         CDS       T01031                                 

Gene name
USP5
Definition
ubiquitin specific peptidase 5 (isopeptidase T)
Orthology
K11836  
ubiquitin carboxyl-terminal hydrolase 5/13 [EC:3.1.2.15]
Organism
mdo  Monodelphis domestica (opossum)
Brite
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100016245 (USP5)
Peptidases [BR:mdo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100016245 (USP5)
Exosome [BR:mdo04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100016245 (USP5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
8
AA seq 857 aa AA seqDB search
MAELSEEALLSVLPTIRVPKAGDRVHKDECAFSFDTPESEGGLYICMNTFLGFGKQYVEK
HYCRTGQRVYLHLQRTRRPKEDDSTSGTGDPPRKKPTRLAIGVEGGFDITEKYEYDEDVK
IVILPDYLEIARDGLGGLPEMVRDRITSAVEALLAADSASRKQEVQAWDGEVRQVSKHAF
NLKQLENPARIPPCGWKCSKCDMRENLWLNMTDGSILCGRRYFDGSGGNNHAVEHYKETG
YPLAVKLGTITPDGADVYSYDEDDMVLDPNLAEHLAHFGIDMLKMQKTDKTMTELEIDMN
QRIGEWELIQESSVQLKPLYGPSYTGIRNLGNSCYLNSVVQVLFSIPDFQRKYVDKLEKI
FQNAPSDPTQDFSTQVAKLGHGLLSGEYSKPAPESGDGEQVPEQKGIQDGIAPRMFKALI
GKGHPEFSTNRQQDAQEFFLHFINMVERNCRSSENPNEVFRFLVEEKIKCLATEKVKYTQ
RVDYIMQLPVPMDAALNKEELLEYEERKRQAEEEKQPLPELVRAQVPFSSCLEAFGAPEQ
VDDFWSTALQAKSVAVKTTRFASFPDYLVIQIKKFTFGLDWVPKKLDVSIEMPEELDISQ
LRGAGLQPGEEELPDIAPPLVTPDEPKGSLGFYGNEDEDSFCSPHFSSPTSPMLDESVII
QLVEMGFPMDACRKAVYYTGNSGAEAAMNWVMSHMDDPDFANPLVLPGSSGPGSTSTVAD
PPSEDCVATIVSMGFSRDQAMKALRATNNNLERAVDWIFSHIDDLDAEAAMDISEGRSAA
DSISESVPVGPKVRDGPGKYQLFAFISHMGTSTMCGHYVCHIKKEGRWVIYNDQKVCASE
KPPKDLGYIYFYQRVTS
NT seq 2574 nt NT seq  +upstreamnt  +downstreamnt
atggcggagctgagtgaggaggcgctgctatctgtattaccgactatccgggtccccaag
gccggagatcgggttcacaaagacgagtgcgccttctccttcgacacaccggagtctgag
ggtggtctctacatttgcatgaataccttcctgggctttgggaaacaatatgttgagaag
cactactgcaggactggccagcgggtctaccttcacctccaaaggacccgccgtccgaaa
gaagacgatagcacttcaggtactggagatcctcctaggaagaagcctactcgattagct
attggtgtggaaggtggctttgacatcacagagaaatatgaatacgatgaggatgtgaag
attgtcattttaccggactacctagagattgcccgagatgggctgggagggctgcctgaa
atggtcagagatcggatcaccagtgcagtggaggccttgctggcagcagactcggcttca
cggaaacaggaggtgcaggcttgggatggggaggtgcggcaagtctccaagcacgccttc
aatctcaagcagctggagaaccctgcccgaatccctccctgtggctggaaatgttccaag
tgtgacatgcgggaaaacctgtggctcaacatgacggatggttccatactctgtggtcgt
cgatactttgatggcagtgggggcaataaccacgcagtagaacattacaaggaaactggc
tacccattggcagtcaagctaggcaccatcacacctgatggtgcagatgtttactcatat
gatgaagatgatatggttctggatcccaacctggcggagcacctagcccattttggtatt
gacatgctaaagatgcagaagacagacaaaacaatgacggagctggagatagatatgaac
cagcggattggtgaatgggagctgatccaggagtccagcgtgcagctcaaacccctctat
ggtcccagttacacgggcatccgaaacttaggcaatagttgttacctcaactccgtggtt
caagtgctcttcagcatccctgacttccagaggaagtatgtggacaagttggaaaagatc
ttccagaacgcaccgtcagaccccacccaggacttcagcacccaggtagccaagctgggc
catggccttctctcaggagagtactccaagccagcaccagaatctggagatggggaacaa
gtgccagagcaaaagggaattcaggatggcattgctcctcgaatgttcaaggccctcatt
ggcaaaggacacccagagttctctaccaaccggcagcaggatgcccaggagttcttcctt
cattttataaatatggttgagaggaactgccgaagctcagaaaacccaaatgaggtattc
cgattcctggtggaagagaagatcaagtgcctggccacagagaaggtcaagtacacgcag
cgagtggactatatcatgcagctgcctgtacccatggatgcagcccttaacaaagaggag
cttttggagtatgaggagagaaaacgccaagcagaagaggagaagcagcctctgccagag
ctggttcgggcccaggtgccttttagttcctgcctggaggcctttggagctcctgagcag
gtggatgacttctggagcacagccctgcaagctaaatctgtggctgtcaagacaacacga
ttcgcctcgttccctgactacctggtcatccagatcaagaagtttacctttggcttggac
tgggtgcccaaaaagctagatgtatctatcgagatgcctgaggagctggatatctcacag
cttcggggggcagggctgcagcctggagaggaggagctccctgacattgctccacccctg
gtcaccccagatgaacccaaaggtagccttggtttctatggaaacgaagatgaagactcc
ttctgctcccctcacttctcctctccgacatcacccatgttggatgaatctgtcatcatt
cagttggtggagatgggcttccccatggatgcctgccgcaaagctgtctactacactggc
aacagtggggctgaagctgctatgaactgggtcatgtcccatatggatgatccagacttt
gcaaacccacttgtcctgcctggctccagtggtcctggctccaccagcaccgtggctgac
cccccatcagaagactgcgtggctactattgtctccatgggcttctcccgggaccaggcc
atgaaagcgcttcgggctacgaacaacaatctcgaacgggccgtggattggatttttagc
cacatcgatgacctggatgcagaggctgctatggacatttcagaggggcgctcagctgca
gattccatctctgaatctgtgcctgtggggcccaaagtccgagatggtcctggaaaatat
cagctctttgccttcatcagtcacatgggtacctctaccatgtgtggtcactatgtctgc
catatcaagaaagaaggcaggtgggttatctacaatgaccagaaagtatgtgcctcggag
aagccacccaaggacctgggctatatttacttctaccagagagtgaccagctaa

DBGET integrated database retrieval system