KEGG   Monodelphis domestica (opossum): 100016271Help
Entry
100016271         CDS       T01031                                 

Gene name
ART1
Definition
ADP-ribosyltransferase 1
Orthology
K06716  
ADP-ribosyltransferase 1 [EC:2.4.2.31]
Organism
mdo  Monodelphis domestica (opossum)
Brite
Enzymes [BR:mdo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     100016271 (ART1)
Cellular antigens [BR:mdo04090]
 Proteins
  100016271 (ART1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4
AA seq 328 aa AA seqDB search
MMQAHIVTSLVLAAFLLVETPKARSHLVSRRDLFSRESALDMAPGSFDDQYAGCVVAMEA
ALPDLNRTEFNASSVYAQAWNAAAARWQERRDQELGGTPTSRRRPPPPGFRDEHAVALLA
YTANSPLHKEFNAAVREAGRSRAYYLRYFPFKTLHFLLTEALRRLGSGQQPRCQQVYRGI
HGVRFRPTGPGTTVRLGAFSSASLKDAAAHQFGEDTFFGIWTCHGVAIKGYSFFPGEEEV
LIPPYETFLVVNASVPSQGPVRIYLKAKDKASTFNCEYIKDKQCTSGRCKLNNSATVERM
EPFSPSQQLLPLLWLFTALSSLDLPSLL
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaagctcacatagtcacttctctggtgctggcagcctttttgctagtggagacc
ccaaaggctcggagccacctagtctcgcgcagggacctcttctcccgagagtctgccctg
gacatggcgccaggctcctttgatgaccagtatgcaggctgtgtagtcgctatggaagcg
gccctccctgacctcaatcgcactgagttcaatgccagctcagtctatgcccaggcttgg
aacgcagcggccgcccgttggcaggagcgccgggatcaggagcttggggggacccctact
tctcgaagacgaccgccacctccgggcttcagagatgagcatgctgtggcccttctagcc
tacacagccaacagccccttgcacaaagagttcaacgcggcagtgagagaggctggccga
tctcgggcttattatctccgatactttcctttcaagacccttcacttcctcctcacagaa
gccctgagacggctgggttctgggcagcagcccaggtgccaacaagtctaccggggcatt
cacggggtccgcttcaggcccacgggacccgggaccacagttcgtctaggggccttttcc
tcggcttccctgaaggatgctgctgcccatcagtttggggaagacactttctttggcatc
tggacttgccatggggtggctattaagggttattccttcttcccaggggaggaggaggtg
ctgattcctccctatgagaccttcctcgtggtcaatgcttcagtgccgtctcaaggtcca
gtccgcatctacctcaaagctaaggacaaggccagcacctttaactgcgagtatatcaaa
gacaagcagtgcacttcaggacgatgcaaactaaataattcagcaacagtagagaggatg
gagcccttctccccatcccaacaactactgcctctgctctggctcttcacggcattgtca
tctctcgacctcccaagtctcctctga

DBGET integrated database retrieval system