KEGG   Monodelphis domestica (opossum): 100016284Help
Entry
100016284         CDS       T01031                                 

Gene name
TPI1
Definition
(RefSeq) triosephosphate isomerase 1
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00010  Glycolysis / Gluconeogenesis
mdo00051  Fructose and mannose metabolism
mdo00562  Inositol phosphate metabolism
mdo01100  Metabolic pathways
mdo01200  Carbon metabolism
mdo01230  Biosynthesis of amino acids
Module
mdo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mdo_M00002  Glycolysis, core module involving three-carbon compounds
mdo_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100016284 (TPI1)
   00051 Fructose and mannose metabolism
    100016284 (TPI1)
   00562 Inositol phosphate metabolism
    100016284 (TPI1)
Enzymes [BR:mdo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     100016284 (TPI1)
Exosome [BR:mdo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100016284 (TPI1)
  Exosomal proteins of bladder cancer cells
   100016284 (TPI1)
  Exosomal proteins of melanoma cells
   100016284 (TPI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 100016284
NCBI-ProteinID: XP_001370168
Ensembl: ENSMODG00000018151
Position
8
AA seq 249 aa AA seqDB search
MASRKFFVGGNWKMNGDKKSLGELITSINGAKVPANTEVVCGAPSIYLDFVRQKLDEKIG
VAAQNCYKVAKGAFTGEISPAMIKDCGVTWVILGHSERRHVFGESDELIGQKVAHALAEG
LGVIACIGEKLDEREAGITEKVVFEQTKAIADNVKDWSKVVLAYEPVWAIGTGKTATPQQ
AQEVHEKLRSWLKTHVSEPVSQSTRIIYGGSVTGANCKDLASQGDVDGFLVGGASLKPEF
LDIIQAKSS
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgcggaagttcttcgtggggggcaattggaagatgaatggagacaagaagagt
ctgggggagctcatcacttctatcaacggggccaaggtgcccgccaacaccgaggtggtg
tgtggagccccttctatctacctagactttgttcgccagaaactggatgagaaaattggc
gtagcggctcagaactgctacaaagtggccaagggagcattcaccggcgagatcagccct
gccatgattaaggactgtggggtcacctgggtgatcctgggccactctgaaaggagacac
gtctttggggagtccgatgagctcattgggcagaaagtagcccacgctctggcagaaggt
ctaggagtgattgcctgtattggtgagaagctggatgaaagagaagctggaatcacagag
aaggttgtttttgaacagaccaaggccattgcagataacgtgaaggactggagcaaagtc
gtactagcctatgagccggtctgggctattgggactggcaagacagcgacaccccagcag
gcccaggaggtccacgagaagcttcgatcatggcttaagacccacgtctcagaacctgta
tcccagagtaccaggatcatttatggaggctctgtgacaggggccaactgtaaggatctg
gcatcccagggggatgtggatggtttcctggtgggtggagcgtccctcaagcctgaattc
ctggacatcattcaagccaaaagctcctag

DBGET integrated database retrieval system