KEGG   Monodelphis domestica (opossum): 100016316Help
Entry
100016316         CDS       T01031                                 

Gene name
MAPK7
Definition
(RefSeq) mitogen-activated protein kinase 7
  KO
K04464  mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo04010  MAPK signaling pathway
mdo04540  Gap junction
mdo04657  IL-17 signaling pathway
mdo04722  Neurotrophin signaling pathway
mdo04912  GnRH signaling pathway
mdo04921  Oxytocin signaling pathway
mdo05206  MicroRNAs in cancer
mdo05418  Fluid shear stress and atherosclerosis
Module
mdo_M00690  MAPK (ERK5) signaling
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100016316 (MAPK7)
 Cellular Processes
  Cellular community - eukaryotes
   04540 Gap junction
    100016316 (MAPK7)
 Organismal Systems
  Immune system
   04657 IL-17 signaling pathway
    100016316 (MAPK7)
  Endocrine system
   04912 GnRH signaling pathway
    100016316 (MAPK7)
   04921 Oxytocin signaling pathway
    100016316 (MAPK7)
  Nervous system
   04722 Neurotrophin signaling pathway
    100016316 (MAPK7)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    100016316 (MAPK7)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100016316 (MAPK7)
Enzymes [BR:mdo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100016316 (MAPK7)
Protein kinases [BR:mdo01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100016316 (MAPK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Haspin_kinase Kinase-like APH Rrn6 Nha1_C
Motif
Other DBs
NCBI-GeneID: 100016316
NCBI-ProteinID: XP_001370188
Ensembl: ENSMODG00000001074
Position
6
AA seq 778 aa AA seqDB search
MAEPRKEEEEEEEEGDAGGRPETGKVEPPNPVTSVVAKNLALLKARSFDVTFEVGDEYEI
IETIGTGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAI
KDILKPTVPYGEFKSVYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMHSAQ
VIHRDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELMLSLH
EYTQAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMTVLGTPSPSVIQAVGAERVRAY
IQSLPPRQPVPWETVYPGADRQALSLLGSMLRFEPGARISAAAALRHPFLAKYHDPDDEP
DCAPPFDFAFDREALTRERIKEAIVAEIGDFHARREGIRQQIRFQPLLQPVAGEQCCPDV
EMPSPRGPSSDCAMESPPPALPPPGPASNTIDLTSAQPPLATGEPAPPKKEGAISDNTKA
ALKAALLKSLRNRLKDGPSAPLEAPEPRKPVTAQERQREREEKRRRRQERAKEREKRQKE
KERKERGVGVGGGPSGDPLAGLVLSDNDRSLLERWTRMAQPPAPPPGPAAPTLLPPSLPP
APTPQLTGPSPLPATISSGLQAPVTPLPIPQPLVPPPSLPGPTGTMPYFPPGPPPSDLGG
SHQASTSESPDVNLVTQQLSKSQVDDLLPPVFSGTPKGSGAGYGVGFDLEEFLNQSFDMG
VADGSHDSQTDSAPLSASLLTDWLEGHGMNPADIESLQREIQMDSPMLLADLPDLQEP
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
atggccgagccgcggaaagaggaggaggaagaggaggaggaaggggacgccggggggcgc
cctgagaccgggaaagtggaaccccccaatcctgtgacttccgtggtggccaagaacctg
gcactgctgaaagcccgctcctttgatgtgacctttgaggtgggagatgaatacgagatc
atcgagaccatcggtacaggagcctacggagtggtctcctctgcccgccgacgtctcact
ggccagcaggtagccatcaagaagatccctaatgcttttgatgtcgtaaccaatgccaag
aggacactccgggagctgaagatccttaaacactttaagcatgacaacatcattgccatc
aaggatattctgaagcccactgtgccctatggggaattcaaatctgtttatgttgtcctg
gacttgatggagagtgacctacaccagatcatccactcctcccagccactcaccttggaa
cacgtacgctacttcttgtaccagctgcttagaggacttaagtatatgcactcagcccag
gtgatccaccgtgacctcaagccctccaacttgctggttaatgaaaactgtgagctaaaa
attggtgattttggcatggccaggggtctttgcacttccccagctgagcatcagtacttc
atgacagaatatgttgccacacgctggtatcgtgcccctgagctcatgctctccttgcac
gagtacacacaggccatcgacttgtggtctgtgggctgcatctttggagagatgctggcc
cgacgacagctctttcctggcaagaactatgtccaccagcttcagctgatcatgacagtg
ttggggactccatcaccatctgtgatccaggctgtaggggctgagcgggtacgtgcctac
atccagagcttgcctccacgccagccagtgccctgggagaccgtgtatccaggtgctgac
cgccaagcgctgtcacttctgggctccatgctgcgctttgagcctggtgctcggatctca
gcggcagctgccctgcgccaccccttcttggccaagtaccatgaccctgatgatgagcca
gactgtgccccaccttttgactttgcctttgaccgggaggccttgacgcgggaacgaata
aaagaggccattgtggctgagattggtgatttccatgcccgacgtgaagggattcgacag
cagatccgtttccagcccttattgcagcctgtggctggggaacaatgctgccctgatgtg
gagatgcctagtccccgaggacccagttcagattgtgccatggagtcgccacctccagcc
ctacctccccctggacctgcatccaacaccattgacttgacatccgctcagcctccttta
gccactggagagccagccccaccgaaaaaggaaggggccatctcagacaataccaaagct
gctctcaaggctgccttgctcaagtccttaaggaaccggcttaaagatggtcccagtgca
cctctggaagcccctgagccacgaaagccagtaactgcccaggagcgacagagggagcgg
gaagaaaagaggagacggcggcaggagcgagccaaggagcgagagaaacgacagaaggag
aaagagcgcaaagaaaggggtgtaggggtggggggtggtccttctggtgatcccctggct
gggctagtgctaagtgacaatgaccggagcttattagaacgctggactcgaatggcccag
cctccagctccacctcctggaccggccgcacctaccctgctaccaccttctcttcctcct
gcacccaccccccaacttactggaccctctccactcccagctactatctcatctggtctc
caggccccagttacacccctcccaatcccccaaccattggtcccacctcctagccttcct
ggtcctacaggaaccatgccttactttccacctggcccacccccatcagatctaggggga
tcccatcaggcttccacttcagagtcacctgacgtgaacctcgtgacccaacagctatct
aagtcgcaggtggatgatctactgcctcctgttttctcaggaaccccaaagggcagtggg
gctggctatggagttggctttgatttggaggagttccttaatcaatcttttgatatgggt
gtggctgatggttcccatgacagccaaacagactcagcccctctgtcagcctccctgctt
actgactggctagaagggcatggaatgaacccagctgacattgaatccctacaacgtgaa
atccagatggactctcctatgcttctggctgacctccctgaccttcaggagccctga

DBGET integrated database retrieval system