KEGG   Monodelphis domestica (opossum): 100016316Help
Entry
100016316         CDS       T01031                                 

Gene name
MAPK7
Definition
mitogen-activated protein kinase 7
Orthology
K04464  
mitogen-activated protein kinase 7 [EC:2.7.11.24]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
MAPK signaling pathway
Gap junction
Neurotrophin signaling pathway
GnRH signaling pathway
Oxytocin signaling pathway
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100016316 (MAPK7)
 Cellular Processes
  Cell communication
   04540 Gap junction
    100016316 (MAPK7)
 Organismal Systems
  Endocrine system
   04912 GnRH signaling pathway
    100016316 (MAPK7)
   04921 Oxytocin signaling pathway
    100016316 (MAPK7)
  Nervous system
   04722 Neurotrophin signaling pathway
    100016316 (MAPK7)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    100016316 (MAPK7)
Enzymes [BR:mdo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100016316 (MAPK7)
Protein kinases [BR:mdo01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100016316 (MAPK7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 778 aa AA seqDB search
MAEPRKEEEEEEEEGDAGGRPETGKVEPPNPVTSVVAKNLALLKARSFDVTFEVGDEYEI
IETIGTGAYGVVSSARRRLTGQQVAIKKIPNAFDVVTNAKRTLRELKILKHFKHDNIIAI
KDILKPTVPYGEFKSVYVVLDLMESDLHQIIHSSQPLTLEHVRYFLYQLLRGLKYMHSAQ
VIHRDLKPSNLLVNENCELKIGDFGMARGLCTSPAEHQYFMTEYVATRWYRAPELMLSLH
EYTQAIDLWSVGCIFGEMLARRQLFPGKNYVHQLQLIMTVLGTPSPSVIQAVGAERVRAY
IQSLPPRQPVPWETVYPGADRQALSLLGSMLRFEPGARISAAAALRHPFLAKYHDPDDEP
DCAPPFDFAFDREALTRERIKEAIVAEIGDFHARREGIRQQIRFQPLLQPVAGEQCCPDV
EMPSPRGPSSDCAMESPPPALPPPGPASNTIDLTSAQPPLATGEPAPPKKEGAISDNTKA
ALKAALLKSLRNRLKDGPSAPLEAPEPRKPVTAQERQREREEKRRRRQERAKEREKRQKE
KERKERGVGVGGGPSGDPLAGLVLSDNDRSLLERWTRMAQPPAPPPGPAAPTLLPPSLPP
APTPQLTGPSPLPATISSGLQAPVTPLPIPQPLVPPPSLPGPTGTMPYFPPGPPPSDLGG
SHQASTSESPDVNLVTQQLSKSQVDDLLPPVFSGTPKGSGAGYGVGFDLEEFLNQSFDMG
VADGSHDSQTDSAPLSASLLTDWLEGHGMNPADIESLQREIQMDSPMLLADLPDLQEP
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
atggccgagccgcggaaagaggaggaggaagaggaggaggaaggggacgccggggggcgc
cctgagaccgggaaagtggaaccccccaatcctgtgacttccgtggtggccaagaacctg
gcactgctgaaagcccgctcctttgatgtgacctttgaggtgggagatgaatacgagatc
atcgagaccatcggtacaggagcctacggagtggtctcctctgcccgccgacgtctcact
ggccagcaggtagccatcaagaagatccctaatgcttttgatgtcgtaaccaatgccaag
aggacactccgggagctgaagatccttaaacactttaagcatgacaacatcattgccatc
aaggatattctgaagcccactgtgccctatggggaattcaaatctgtttatgttgtcctg
gacttgatggagagtgacctacaccagatcatccactcctcccagccactcaccttggaa
cacgtacgctacttcttgtaccagctgcttagaggacttaagtatatgcactcagcccag
gtgatccaccgtgacctcaagccctccaacttgctggttaatgaaaactgtgagctaaaa
attggtgattttggcatggccaggggtctttgcacttccccagctgagcatcagtacttc
atgacagaatatgttgccacacgctggtatcgtgcccctgagctcatgctctccttgcac
gagtacacacaggccatcgacttgtggtctgtgggctgcatctttggagagatgctggcc
cgacgacagctctttcctggcaagaactatgtccaccagcttcagctgatcatgacagtg
ttggggactccatcaccatctgtgatccaggctgtaggggctgagcgggtacgtgcctac
atccagagcttgcctccacgccagccagtgccctgggagaccgtgtatccaggtgctgac
cgccaagcgctgtcacttctgggctccatgctgcgctttgagcctggtgctcggatctca
gcggcagctgccctgcgccaccccttcttggccaagtaccatgaccctgatgatgagcca
gactgtgccccaccttttgactttgcctttgaccgggaggccttgacgcgggaacgaata
aaagaggccattgtggctgagattggtgatttccatgcccgacgtgaagggattcgacag
cagatccgtttccagcccttattgcagcctgtggctggggaacaatgctgccctgatgtg
gagatgcctagtccccgaggacccagttcagattgtgccatggagtcgccacctccagcc
ctacctccccctggacctgcatccaacaccattgacttgacatccgctcagcctccttta
gccactggagagccagccccaccgaaaaaggaaggggccatctcagacaataccaaagct
gctctcaaggctgccttgctcaagtccttaaggaaccggcttaaagatggtcccagtgca
cctctggaagcccctgagccacgaaagccagtaactgcccaggagcgacagagggagcgg
gaagaaaagaggagacggcggcaggagcgagccaaggagcgagagaaacgacagaaggag
aaagagcgcaaagaaaggggtgtaggggtggggggtggtccttctggtgatcccctggct
gggctagtgctaagtgacaatgaccggagcttattagaacgctggactcgaatggcccag
cctccagctccacctcctggaccggccgcacctaccctgctaccaccttctcttcctcct
gcacccaccccccaacttactggaccctctccactcccagctactatctcatctggtctc
caggccccagttacacccctcccaatcccccaaccattggtcccacctcctagccttcct
ggtcctacaggaaccatgccttactttccacctggcccacccccatcagatctaggggga
tcccatcaggcttccacttcagagtcacctgacgtgaacctcgtgacccaacagctatct
aagtcgcaggtggatgatctactgcctcctgttttctcaggaaccccaaagggcagtggg
gctggctatggagttggctttgatttggaggagttccttaatcaatcttttgatatgggt
gtggctgatggttcccatgacagccaaacagactcagcccctctgtcagcctccctgctt
actgactggctagaagggcatggaatgaacccagctgacattgaatccctacaacgtgaa
atccagatggactctcctatgcttctggctgacctccctgaccttcaggagccctga

DBGET integrated database retrieval system