KEGG   Monodelphis domestica (opossum): 100016433Help
Entry
100016433         CDS       T01031                                 

Gene name
AOX2
Definition
(RefSeq) aldehyde oxidase 2
  KO
K00157  
aldehyde oxidase [EC:1.2.3.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Valine, leucine and isoleucine degradation
Tyrosine metabolism
Tryptophan metabolism
Vitamin B6 metabolism
Nicotinate and nicotinamide metabolism
Retinol metabolism
Drug metabolism - cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100016433 (AOX2)
   00350 Tyrosine metabolism
    100016433 (AOX2)
   00380 Tryptophan metabolism
    100016433 (AOX2)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    100016433 (AOX2)
   00760 Nicotinate and nicotinamide metabolism
    100016433 (AOX2)
   00830 Retinol metabolism
    100016433 (AOX2)
  Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    100016433 (AOX2)
Enzymes [BR:mdo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.3  With oxygen as acceptor
    1.2.3.1  aldehyde oxidase
     100016433 (AOX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
7
AA seq 1343 aa AA seqDB search
MPSHLQSNELVFFVNGKKITEKNADPEVNLLSYLRKIRLTGTKYACGGGGCGACTVMVSK
YDPISKKIRHYAVTACLLPICSLHGAAVTTVEGIGSTRTRIHPIQERIAKGHGTQCGFCT
PGMVMSLYALLRNHPEPSPQQLTEALGGNLCRCTGYRSILESSKTFCAESNCCQMKGTGK
CCLDQEENPTLLSHQKNDICTQLFTKEEFQPLDPTQELIFPPELLRMADDLNKETLTFYG
ERVTWISPATLKELLELKVKYPESPLVVGNTSVGPAMKSKGHVHPVLLSPARISELSMVT
NTNDGLTIGAGCSLAQVKQILTDEVSKLPEKKTRTYQALLKHLRSLAGQQIRNMASLGGH
IISRHGYSDLNPILAVGNTTLNLVSKEGRRQIPLNENFLAGLANADLKPEEILESVHIPH
SDKWEFVAAFRQAQCQQNALPDVNCGMRVLFKEDSDTIADLSIFYGGLGSATVSAQKSCQ
QLLGRRWNALMLDEAYRLILDEVSLPGSAPGGMVEFKRTLIVSFLFKFYLGVLQELKKMV
KMTSLPNNHRYPDISEKFLSALEEFPVTISRGVQAFQVDPTQSPNDPVGRPILHQSGIKH
ATGEAIFCDDMPVVDKELFLALVTSTKAHAKIISIDASEALELPGVVDVITAEDIPGTNG
TEDDRLLPVDEVLCVGHIICAVAAESDVYAKRAVEKVKIIYEDQEPVIFTIEDAIRHNSY
LSCEKKLEQGNVEEAFENVDQIIEGEIHVGGQEHFYMETQRALAIPKVEDQEMEIYVSSQ
DPSHVQKTVSSTLNVPINRITCHVKRVGGGFGGKVSKPAVYGAITAVAANKTGRPVRLVL
DRREDMLMTGGRHPLFAKYKVGFMNNGRIKAMDVQCYINGGYTLDDSELVIEYLLLKLEN
AYKINNLRFLGRPCKTNLPSNTAFRGFGFPQGGLVMESCITAVAAKCGLPPEKVREKNMY
KRIDKTIYKQAYSPDKLLRCWNECLDQSSYHSRKAKVEEFNSKNYWKKKGIAIVPMKFSV
GFGATSYHQAAALVHIYTDGSVLVTHGGSELGQGIHTKMIQIASRELKIPMSYMHFCETS
TATVPNTIATAASVGADVNGKAVQNACQILLKRLDPIIKKNPEGTWEEWVEAAFEQRISL
SATGYFRGYKANMDWEKGEGDPFPYYVDGAACSEVEIDCLTGAHKNIRTDIVMDASCSIN
PAIDIGQIEGSFIQGLGLYTLEELKYSPEGLLHSKGPDEYKIPTVSDVPEELNVSLLASS
QNPMAIYSSKGLGESGMFLGCSVFFAISDAVTAARKERGLMEDFMLNSPATPERIRMACA
DRFTEMIPIDDAETFKPWCIPIA
NT seq 4032 nt NT seq  +upstreamnt  +downstreamnt
atgccttcccatttgcaatccaatgaactggtcttctttgtgaatggaaaaaagatcaca
gagaagaatgcagatcctgaagtcaatctactgtcctacctgagaaagatccgtctcaca
gggaccaagtatgcttgtggaggaggaggctgtggagcctgcacagtgatggtatcaaag
tatgatcccatttccaagaagataagacattatgcagttacagcttgtctgcttcccatc
tgctctctgcatggggctgcagtcaccacagtggaaggtattggcagcaccaggacccgg
attcatcccattcaggagaggattgccaaaggccacggcacccagtgtggattctgcacc
ccagggatggtgatgtccttgtatgctctcctgaggaaccacccagagccctcgccacaa
cagctgactgaagccctgggaggtaatctatgccgctgtactggatatcgctcaattcta
gaaagcagcaaaactttctgtgcggagtcaaactgctgtcaaatgaagggaacaggaaaa
tgctgtttggatcaagaagaaaatccaactttattgtctcatcagaaaaatgatatctgt
acccaactattcacaaaagaggagttccagcctttggacccaacccaggagctcatcttc
cccccagaactcttgagaatggcagatgatctgaataaagaaactctgactttctatggt
gagagagttacttggatttctcccgcaacactaaaagaacttctggagctgaaagtaaag
tatcctgaatctcctcttgtcgtagggaacacctcagtgggaccagcaatgaaatccaaa
ggacatgttcacccagttcttctctccccagccagaatttctgagctaagtatggtgact
aatacaaatgatgggctgacaattggagctggctgcagcctggcccaggtgaagcagatc
ctaacagatgaggtctccaagcttccagagaaaaagacacggacataccaggctctcttg
aagcacttgagaagtttggctggccaacagatcaggaacatggcttccttaggtggacac
atcatcagccgacatggctattccgatctgaatccaatcctggctgtgggaaacaccacc
cttaatctggtgtccaaagaaggaagacggcagattcctttaaatgaaaattttcttgct
ggtttggcaaatgcagacctgaagcctgaggaaattttggagtcggtgcacatacctcac
tctgataagtgggaattcgtggcagcattcagacaagcccagtgtcagcaaaatgccttg
cctgatgttaactgtggaatgagagtccttttcaaagaagactcggataccatcgcagac
cttagcatcttctacggaggcttaggatcagccactgtcagtgcacaaaaatcctgccag
cagctcctaggaaggcgctggaatgctttgatgctggatgaagcttacaggctgatcctg
gacgaagtttctcttccaggctcagctccagggggaatggtggaattcaaaagaaccctc
attgtcagttttctcttcaagttctacctgggagtattacaagaactaaagaagatggta
aagatgacctctcttcctaacaaccatcgatatcctgacatttcagagaagttcctaagt
gctctggaagagtttcctgtcacaatatccagaggagttcaagcattccaagtagaccct
acccaatctcccaatgatccggttggacgcccaattctgcatcagtctggtatcaaacac
gccactggggaagctatattttgtgatgacatgcctgttgtggataaagaacttttcctg
gctttggtaaccagcaccaaggctcatgcaaaaatcatatctattgatgcatccgaggcc
cttgaactgccaggtgttgttgatgtgataacagctgaggacattccaggtaccaatggc
actgaggatgacagactacttcctgtagatgaggtgctttgtgtgggacatattatctgt
gctgtggctgctgagtcagatgtttatgcaaagcgggcagtggagaaggtgaaaatcatt
tatgaggaccaggagcctgtgattttcaccattgaggatgcaataaggcacaattcatac
ctgtcctgtgaaaaaaaactagaacaaggaaatgtggaggaggcatttgaaaatgttgat
caaattattgagggtgagatacacgttggaggacaggaacatttttacatggagacacaa
agagcacttgccatccccaaagtggaggaccaagagatggagatttatgtatcatctcag
gatccatcccacgtgcagaaaacagtttcctctactttaaatgtccccatcaacagaatc
acatgccacgtaaaacgagttggtggaggttttgggggaaaggtctccaaaccagctgtg
tatggtgcaatcactgcagtggctgctaacaaaactggtcgtcctgttcggcttgtttta
gacagaagagaggatatgttaatgacagggggaaggcatccactttttgcaaaatacaaa
gtaggattcatgaacaatgggaggatcaaggctatggatgttcagtgttatatcaatgga
gggtataccctggatgactctgaactggtgatagaatatcttctactaaagctggaaaat
gcttataaaattaataatctccgattcttgggtcggccctgcaaaaccaatttgccatcc
aatacagccttccgtggatttggttttccacaaggtggactggtaatggaatcttgcatc
acagcagtggcagccaagtgtggcttaccaccagaaaaggttcgggagaaaaatatgtac
aaaagaatcgacaaaacgatctacaaacaagcatacagccccgataagctgctaagatgt
tggaatgaatgtctggaccagtcttcatatcacagcaggaaagcaaaagtggaagaattt
aattccaagaattactggaaaaagaaaggcattgctatcgtccccatgaagttctcggtg
ggttttggcgcaacaagttaccatcaggcagctgcactggttcatatatatacagatggg
tctgtattggtaactcatggaggaagcgagctggggcaaggtattcacaccaaaatgata
cagattgccagccgtgaattaaagataccgatgtcctacatgcacttctgtgaaacaagt
acagccacagtgcctaacactattgctactgctgcatccgttggagctgacgtcaacggg
aaggctgtgcagaatgcctgtcagattcttttgaaacgccttgatcccatcattaagaaa
aatcctgaaggcacatgggaagaatgggttgaagcagcatttgaacagagaatcagcctt
tcagctacaggatacttcagaggctataaggcgaacatggactgggagaaaggggaaggt
gacccatttccatactatgttgatggagctgcgtgttctgaagttgaaattgactgcctg
acaggagctcataagaacataagaactgacatagtcatggatgcaagttgcagcataaat
ccagccatagatataggacagattgaaggctcattcattcagggcttgggactttataca
ctagaagaattaaaatattctcccgaaggactattgcattctaagggacccgatgagtat
aaaattcctacagtctctgacgtcccagaggagcttaatgtttccttattggcatcatca
cagaacccaatggcaatctattcatctaaaggcctgggtgagtcaggtatgttcctggga
tgttctgtgttctttgccataagtgatgcagtgacagcagctcgcaaagaaaggggttta
atggaagattttatgctgaacagtccagcaactccagaacgaattcgaatggcttgtgca
gacagattcacggagatgatcccaatagatgatgcagagacctttaagccttggtgtatc
cctatagcttaa

DBGET integrated database retrieval system