KEGG   Monodelphis domestica (opossum): 100016512Help
Entry
100016512         CDS       T01031                                 

Gene name
CLK1
Definition
CDC-like kinase 1
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Legionellosis
Class
Human Diseases; Infectious diseases; Legionellosis [PATH:mdo05134]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7
AA seq 487 aa AA seqDB search
MRHSKRTNCSDWFEKESWDRRKWSSSISGHKRRKRSHSSSRENKRCKHNHSKIYERHYLE
ARCINERDYRNRRYIDEYRNDYCQGYESGYHYREQESGYYNHSSKSSGRSGRSHYKRKHK
SHRSTAHRRSHAKSHRRKRSRSVEDDEEGHLICQSGDVLSARYEIVDTLGEGAFGKVVEC
IDHKAGGKRVAVKIVKNVDRYSEAAHSEIQVLEHINSTDPNSTFRCVQMLEWFEHLGHVC
IVFELLGLSTYDFIKENSFLPFGMDHIRKMAYQICKSVNFLHSNKLTHTDLKPENILFVQ
SDYTEEYNPKMRRDERTVKNPDIKVVDFGSATYDDEHHSTLVSTRHYRAPEVILALGWAQ
PCDVWSIGCILIEYYLGFTIFPTHDSKEHLAMMERILGPLPKHMIQKTRVQKYFRHYQLD
WDEHSSAGRYVSRRCKPLKEFMHSQDADHELLFDLIQKMLEYDPSKRITLTEALKHPFFF
SLKKENI
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgcgacattcaaagagaacaaattgctctgattggtttgaaaaggaaagttgggatcga
agaaaatggagtagcagtatcagtggtcataagcgaaggaagagatcacatagcagttca
cgggagaacaaacgctgcaaacataatcactcgaaaatttatgaacgccattatttggaa
gccaggtgtataaatgagagagattatcgtaatcgacgctacatcgatgaatatagaaat
gactactgtcaaggatatgaaagcggctatcactatagagaacaggaaagtggttattat
aatcacagtagcaagtcttctggtagaagtggaagaagtcattataaaagaaaacacaag
agtcaccgcagtactgcacaccgtcgttcacatgcgaagagtcaccgaaggaaaagatcc
aggagtgtagaggatgatgaggagggtcacctgatctgtcagagtggagacgtactaagt
gcaagatatgaaattgttgatactttaggagaaggggcttttggaaaagttgtggaatgc
atcgatcataaagcgggaggtaaacgtgtagcagtaaaaatagtgaaaaatgtggataga
tattctgaagcagctcattcggaaatacaagttttggaacacataaattcaacagatcct
aacagcacatttcgctgtgttcagatgttggaatggtttgagcatcttggtcacgtttgt
attgtatttgaacttctgggtcttagcacttatgacttcattaaagaaaacagctttttg
ccatttggaatggatcacatcaggaaaatggcatatcagatatgcaaatctgtaaatttt
ttgcacagtaataaattaactcatactgacctgaagcctgaaaatattttatttgttcag
tcagactacacagaagagtataatcccaaaatgagacgtgatgagcgtacagtaaaaaat
ccagatattaaagttgtagactttggaagtgcaacatatgatgatgaacatcatagtacc
ttggtttctacaagacattacagagcacctgaagttattttagctctaggatgggctcaa
ccgtgtgatgtttggagtatagggtgcattctcattgagtactatctgggattcacaata
tttcctacacatgacagtaaggaacatttggcaatgatggaaaggattttaggaccttta
cccaaacatatgattcagaaaaccagggtacaaaaatatttccgtcattatcagttagat
tgggatgaacacagttctgctggtagatatgtttcacggcgttgcaagcctctaaaggaa
tttatgcattctcaagatgctgaccatgagcttctctttgacctcatccagaaaatgtta
gagtatgatccatccaaaagaattactctcacagaagccttgaaacatcctttctttttc
tctctgaagaaagaaaatatatga

DBGET integrated database retrieval system