KEGG   Monodelphis domestica (opossum): 100016522Help
Entry
100016522         CDS       T01031                                 

Gene name
PFN1
Definition
profilin 1
Orthology
K05759  
profilin
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Rap1 signaling pathway
Regulation of actin cytoskeleton
Salmonella infection
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100016522 (PFN1)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100016522 (PFN1)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100016522 (PFN1)
Exosome [BR:mdo04147]
 Exosomal proteins
  Proteins found in most exosomes
   100016522 (PFN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 140 aa AA seqDB search
MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKSFANITAAEVGVLVGKDRSSFF
VNGLTLGGQKCSVIRDSLLVDGEYTMDLRTKSTGGAPTYNITVTMTAKTLVLLMGKEGIH
GGMINKKCYEMATHLRRSQY
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggccggttggaacgcctacatcgacaacctcatggcggacgggacctgtcaggacgcg
gccatagtcggctataaggactcgccctcggtctgggccgccgtacccgggaaaagcttc
gccaatattacggcagctgaagtaggtgtattggttggcaaagatcgttcaagttttttc
gtaaatgggctgacacttgggggccagaaatgttcagtgatcagggattcgctgctggta
gatggagagtacaccatggaccttcgtacaaagagcactggaggtgctcccacctacaac
atcactgtcaccatgactgccaagacgctagtcctgctgatggggaaggaaggtatccat
gggggaatgatcaacaagaagtgttatgaaatggctacccaccttcgacgctctcaatac
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system