KEGG   Monodelphis domestica (opossum): 100016615Help
Entry
100016615         CDS       T01031                                 

Gene name
RXRG
Definition
(RefSeq) retinoid X receptor gamma
  KO
K08526  retinoid X receptor gamma
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo03320  PPAR signaling pathway
mdo04659  Th17 cell differentiation
mdo04919  Thyroid hormone signaling pathway
mdo04920  Adipocytokine signaling pathway
mdo04928  Parathyroid hormone synthesis, secretion and action
mdo05200  Pathways in cancer
mdo05202  Transcriptional misregulation in cancer
mdo05216  Thyroid cancer
mdo05222  Small cell lung cancer
mdo05223  Non-small cell lung cancer
mdo05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Organismal Systems
  Immune system
   04659 Th17 cell differentiation
    100016615 (RXRG)
  Endocrine system
   04920 Adipocytokine signaling pathway
    100016615 (RXRG)
   03320 PPAR signaling pathway
    100016615 (RXRG)
   04919 Thyroid hormone signaling pathway
    100016615 (RXRG)
   04928 Parathyroid hormone synthesis, secretion and action
    100016615 (RXRG)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100016615 (RXRG)
   05202 Transcriptional misregulation in cancers
    100016615 (RXRG)
   05226 Gastric cancer
    100016615 (RXRG)
   05216 Thyroid cancer
    100016615 (RXRG)
   05222 Small cell lung cancer
    100016615 (RXRG)
   05223 Non-small cell lung cancer
    100016615 (RXRG)
Transcription factors [BR:mdo03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    100016615 (RXRG)
Nuclear receptors [BR:mdo03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   100016615 (RXRG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_recep Nuc_recep-AF1 zf-C4
Motif
Other DBs
NCBI-GeneID: 100016615
NCBI-ProteinID: XP_007480745
Ensembl: ENSMODG00000001291
Position
2
AA seq 493 aa AA seqDB search
MDFSQCLVALFETVLIKFGPEGIGMKRTLKLRFKRLTQVTSSSSLSHTNSTSMSPSPAVT
TGKSTDSHSNYIEAPVSVPRTLASPLSAIGSPLNALGSSYRVITSAIGPHSLSLATSPGV
NMVGPASSQLNVMNNVRSSDDVKPLPVLPGMGTMSYPSTSPSSLAKHICAICGDRSSGKH
YGVYSCEGCKGFFKRTIRKDLIYTCRDNKDCLIDKRQRNRCQYCRYQKCLVMGMKREAVQ
EERQRSRERAENEVESTSSGHEDMPVERILEAELAVEPKTESYGDTNMENSTNDPVTNIC
HAADKQLFTLVEWAKRIPHFSDLTLEDQVILLRAGWNELLIASFSHRSVSVQDGILLATG
LHVHRSSAHSAGVGSIFDRVLTELVSKMKDMQMDKSELGCLRAIVLFNPDAKGLSNPSEV
EGLREKVYATLEAYTKQKYPDQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDT
FLMEMLETPLQIT
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggatttttctcaatgcctggtggcactgtttgagactgttctgataaagtttgggcca
gagggaattggcatgaagaggacactgaagctgaggtttaaacgacttacccaagttaca
tcatctagttctctcagtcacactaactccacatctatgagcccatcaccagctgtgacc
acaggaaaatccacagacagtcactccaactacattgaggctccagtcagtgttccaagg
acacttgcctccccactgagtgccattgggtctcctttgaatgctctgggttcttcatat
cgagtcattacatcagccataggacctcactccttatccctggctacttctccaggtgtc
aacatggttggtccagccagttctcagctcaatgtcatgaacaatgtcaggagctcagat
gatgtcaagcccttgccagtgcttccagggatgggaaccatgagctatccatccactagc
ccaagctcccttgccaaacatatctgtgccatttgtggagacagatcatcagggaagcac
tatggggtgtacagttgtgaaggctgtaaagggttcttcaagaggaccataaggaaagac
ctcatctacacatgccgggataacaaggattgcctcattgataagcgccagcgtaaccgc
tgccaatactgtcgatatcagaagtgccttgtcatgggtatgaaaagggaagctgtgcaa
gaggagaggcagaggagtcgagagagagctgagaatgaagtggagtccaccagcagtggc
catgaagatatgcccgtggagaggatcctagaagcagaacttgctgttgaaccaaagact
gaatcctatggtgacacaaacatggagaactcaaccaatgatcctgtcaccaatatatgc
catgctgctgataagcaactctttactcttgtggaatgggccaaacgcatcccacacttc
tctgacctcaccttggaagaccaagttattcttcttcgggcaggctggaatgaattgctg
attgcctccttctcccatcgctccgtgtctgtgcaggatggaatcctcctagccactggt
ttacatgttcacagaagcagtgcccatagcgctggtgttggctctatctttgacagagtg
ctcactgagctggtttctaaaatgaaagacatgcagatggacaaatctgagttaggctgc
ctgcgagccattgtcctgtttaacccagatgctaaaggtctttccaatccctctgaagtg
gagggtctccgagaaaaggtttatgctacccttgaagcatacaccaaacagaaataccct
gatcagcctggcagatttgccaagctccttcttcgactcccagcactccggtccatcggc
ttgaaatgtcttgaacacctcttcttcttcaagcttattggagatacacccattgatact
tttctcatggagatgctggaaactcccctccagattacctga

DBGET integrated database retrieval system