KEGG   Monodelphis domestica (opossum): 100016623Help
Entry
100016623         CDS       T01031                                 

Definition
mitogen-activated protein kinase 15-like
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
mdo  Monodelphis domestica (opossum)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 579 aa AA seqDB search
MSATEVDEHVSQLYLIKRRLGKGAYGIVWKAVDRRTGEIVAIKKIFDAFRNKTDAQRTFR
EIMFLQEFDNHPNIIRLLNVIRAENDRDIYLVFESMDTDLHSVIRKGNLLKDIHKCYILY
QLLRATKFIHSGNVIHRDQKPSNVLLDADCCVKLCDFGLARSLSQLHEEPGNPALTEYVA
TRWYRAPEILLSSHRYTQGVDMWSLGCILGEMLLGRPLFPGTSTLNQLELILAAIPAPNK
EDFLTFGSDYSASVLHRMGPRQLLTLGSRLPPSTPPEALDLLERLLVFDPEKRLTADEAL
RHPYVKRFHCPAKEPALDYEVTLPVDDGVQLSVMEYRNRLYRMILERKSNNRHQRLEIQK
EGLGDLPRASSLPLPSQKDPYLQNSASDPTQAPGELRPPGLRELRSKISGSRPQSEPSPF
HDTLGPRQGSAPSIRPQHRGFTGKRGQSFWGDARSLTGTPGERPGLRWAPSTPSLTAQAA
AAVTNQALTRKDSPLAGVMTTTSTRLVPRLPPGQAQDIRTPLRPTKRMFQSFGSQGTLGG
ARASLGGYSQAYGTIWRSALYGLPLTYSSLSPLPNVPPS
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atgagcgcgactgaggtggacgaacacgtgtcccagctctaccttatcaagcggcgcctc
gggaagggggcctatggcatcgtttggaaagctgtggatcggaggacaggagaaattgtg
gccattaagaagatctttgatgccttcaggaataagacagatgcacagagaacgttccga
gaaatcatgtttcttcaggagtttgataatcatcccaacatcatccgtcttttgaatgtc
atcagagcagaaaatgacagggacatttacctagtatttgaatccatggacacagacctg
cattctgtcatccggaaagggaacctgctgaaggatattcacaagtgttacatcctttac
caacttctacgtgcgaccaagttcattcactcggggaatgtcatccacagagaccaaaag
ccctccaatgttcttctggatgctgactgttgtgtgaaactctgtgactttggccttgca
cgttccctgagtcaacttcatgaggaaccagggaacccagccctgacagaatatgtggcc
acacgctggtaccgagccccagaaatcctcttatcttcacaccggtacacacagggtgtg
gacatgtggagcttgggctgtatcctaggggagatgctgcttgggagacctttgttccca
ggaacttctacccttaaccagcttgagctgatccttgcagccatcccagccccaaacaaa
gaagacttcctgacctttggttcagactacagtgcctctgttctccaccgaatggggccc
aggcagctactgaccctgggctcccgcctgccaccatctacccctcctgaggccctggat
ctgttagaaagactcctggtgtttgaccctgagaagcgactgactgcagatgaggctcta
aggcacccttatgtgaaaaggttccattgtccagccaaggaaccagccctggactatgaa
gtgaccctgcctgtggatgacggtgtgcagctctctgtgatggagtatcgtaaccggctc
tacaggatgatcctggagcgaaaatcaaacaatcggcatcaaaggttggaaattcagaaa
gaaggcctgggggacctccccagggcaagctctttgcccctaccctcccagaaggatccc
tatctgcagaattctgcctctgatccaacccaggccccaggggaactgcgaccccctggc
ctgagagaacttcgttcaaaaatttctggatccagaccacaaagtgaaccctctcccttc
catgacacccttggtccccggcaggggtcagcaccctctatccggccacaacatcgaggt
ttcacagggaagaggggacaatcattttggggtgatgctcgcagtctcactggcacccct
ggggagaggccaggcctcagatgggccccctctaccccctctctcactgcccaagcagca
gctgcagtgaccaaccaggccctgacacgaaaggacagtcccctggcaggtgtgatgact
accacaagcaccaggctggtccctcgtctgccccctggccaagctcaggatattcgaact
cccctgcggcccacaaaaaggatgttccagtcctttggctcccaggggacgttaggggga
gctagggcctccctaggaggctattctcaagcctatggaaccatctggaggtcagccctg
tatggcctacccctcacttactcttccttaagtcccctccccaatgtacctccatcctga

DBGET integrated database retrieval system