KEGG   Monodelphis domestica (opossum): 100016651Help
Entry
100016651         CDS       T01031                                 

Definition
baculoviral IAP repeat-containing protein 4-like
Orthology
K04725  
E3 ubiquitin-protein ligase XIAP
Organism
mdo  Monodelphis domestica (opossum)
Pathway
NF-kappa B signaling pathway
Ubiquitin mediated proteolysis
Apoptosis
Focal adhesion
Toxoplasmosis
HTLV-I infection
Pathways in cancer
Small cell lung cancer
Class
Genetic Information Processing; Folding, sorting and degradation; Ubiquitin mediated proteolysis [PATH:mdo04120]
Environmental Information Processing; Signal transduction; NF-kappa B signaling pathway [PATH:mdo04064]
Cellular Processes; Cell growth and death; Apoptosis [PATH:mdo04210]
Cellular Processes; Cell communication; Focal adhesion [PATH:mdo04510]
Human Diseases; Cancers; Pathways in cancer [PATH:mdo05200]
Human Diseases; Cancers; Small cell lung cancer [PATH:mdo05222]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:mdo05166]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:mdo05145]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
X
AA seq 498 aa AA seqDB search
MTFKSFEDSKTCVPPDINKDEDFVEEFNRLKTFANFPSSSPISASTLARAGFLYTGEGDT
VKCFSCHAAVDRWQYGDSAVGRHRKVSPNCRFINGFYFEKNATRFPNPIIQNCQYRVENC
SRNRNHFALERPSETHGEYLLRTGQVIDMSDTIYPRNPSMCSEEARLRSFQNWPDYAHLT
PQELASAGLYYMGFEDQVQCFCCGGKLKNWEPCDRAMSEHKRHFPKCFFVLGRDVGNTRI
ETDVSCDRSCPNPTHLPRNPAMADYEARLITFATWIYSVNKEQLAKAGFYALGDHDKVLC
FHCGGGLTDWKPNEDPWEQHAKWYPGCKYLLEEKGQEYVSSIHLVHPFNSSMVKSRKMAS
SVTQEIDDSVLQNPLVQDAIRMGFNFLEIKKIMREKIQSSGNNYTSLELLVADLVSAQKE
SSQDGESSPTLSEKEISTEEQLRRLQEEKLCKICMDENIAVVFIPCGHLVSCQLCAEAID
KCPMCYTVITFKQKIFMS
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgacttttaagagttttgaagattctaaaacttgtgtgcctccagacatcaataaagat
gaagattttgtagaggaatttaatagattaaagacatttgctaatttcccaagtagtagc
cctatttccgcatcaacattggcgcgagcaggtttcctctatactggtgagggagatact
gtcaagtgctttagctgtcatgcagctgtagatagatggcagtatggagactcagcagtt
ggaagacatagaaaagtatccccaaactgcagatttattaatggtttttattttgaaaaa
aatgctacacggtttccaaatcccattatccaaaactgtcagtacagagttgaaaattgt
tcaaggaatagaaatcactttgctttggagagaccctctgaaactcatggggaatatctt
ttgagaacaggccaggtcattgatatgtcagataccatatacccacggaatccttccatg
tgtagtgaagaagctcgactgagatcttttcagaattggccagactatgctcaccttacc
ccacaggagttagcaagtgctggactctattacatgggctttgaggatcaagtgcagtgc
ttttgttgtgggggcaaattaaagaattgggaaccgtgtgatcgggcaatgtccgaacac
aagaggcatttccctaagtgtttttttgtcttgggacgggatgttggtaatacacgaatt
gaaactgatgttagctgtgataggagttgcccaaaccctacccatctcccaaggaatcca
gccatggcggattatgaagcacgactcattacctttgcaacatggatatactcggttaac
aaggagcagcttgcaaaagctggattttatgctttaggtgaccacgataaagtactatgc
tttcattgtggaggtggacttactgattggaaacccaacgaagacccttgggaacagcat
gctaagtggtatcctggatgtaaatatctattagaagaaaagggccaggaatatgtcagc
agtattcatttagtgcatccatttaacagttctatggtaaaatctcgcaaaatggcttca
tcagtaactcaagaaattgatgacagtgtgttgcagaatcctctggtacaagatgccata
cgaatgggtttcaattttcttgaaattaagaaaatcatgagagaaaagatacaatcatct
ggaaacaactatacatcgcttgaacttctggtagcagatctagtgagtgctcagaaagaa
agctcacaagatggagagtcaagtccaactttatcagagaaagagattagtaccgaagaa
cagctcagacgtttgcaagaggaaaagttgtgtaagatctgcatggatgagaacatcgct
gttgttttcatcccttgcggacatctggttagctgtcagctgtgtgccgaagcaattgac
aagtgtccgatgtgttacactgtcattactttcaagcaaaaaatttttatgtcttga

DBGET integrated database retrieval system