KEGG   Monodelphis domestica (opossum): 100016737Help
Entry
100016737         CDS       T01031                                 

Gene name
TPM1
Definition
(RefSeq) tropomyosin 1 (alpha)
  KO
K10373  tropomyosin 1
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo04260  Cardiac muscle contraction
mdo04261  Adrenergic signaling in cardiomyocytes
mdo05206  MicroRNAs in cancer
mdo05410  Hypertrophic cardiomyopathy (HCM)
mdo05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Organismal Systems
  Circulatory system
   04260 Cardiac muscle contraction
    100016737 (TPM1)
   04261 Adrenergic signaling in cardiomyocytes
    100016737 (TPM1)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    100016737 (TPM1)
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    100016737 (TPM1)
   05414 Dilated cardiomyopathy (DCM)
    100016737 (TPM1)
Cytoskeleton proteins [BR:mdo04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Tropomyosins
     100016737 (TPM1)
Exosome [BR:mdo04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   100016737 (TPM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tropomyosin Tropomyosin_1 CLZ TMF_DNA_bd Laminin_II
Motif
Other DBs
NCBI-GeneID: 100016737
NCBI-ProteinID: XP_001365779
Ensembl: ENSMODG00000011135
Position
1
AA seq 284 aa AA seqDB search
MDAIKKKMQMLKLDKENALDRAEQAEADKKAAEDRSKQLEEDISAKEKLLRVAEDERDRV
LEELHKAEDSLLTADETAAKAEADVASLNRRIQLVEEELDRAQERLATALQKLEEAEKAA
DESERGMKVIESRAQKDEEKMEIQEIQLKEAKHIAEDADRKYEEVARKLVIIESDLERAE
ERAELSEGQVRQLEEQLRIMDQTLKALMAAEDKYSQKEDKYEEEIKVLSDKLKEAETRAE
FAERSVTKLEKSIDDLEEKVAHAKEENLSMHQMLDQTLLELNNM
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atggatgccatcaagaagaagatgcagatgctgaagctggacaaggagaatgccttggac
cgggctgagcaggcagaggccgacaagaaggcggcggaggaccggagcaagcagctcgag
gaagacatttcggccaaggagaagctgctgcgcgtggcggaggatgagcgggaccgggtg
ctggaggagctgcataaggcggaggacagcctcctcaccgcagatgaaaccgccgccaag
gctgaagccgatgtagcttctttgaacagacgtatccagctggttgaggaagagttggac
cgtgctcaggagcgcctggcaactgccctgcagaaattggaggaggctgaaaaggcagca
gatgagagtgagagaggaatgaaggtcattgaaagcagagcccaaaaggatgaggagaaa
atggaaattcaggagatccagcttaaagaggctaagcacattgctgaggatgctgaccgc
aaatatgaagaggtggcccggaaactggtcatcattgagagtgatttggagcgtgcagaa
gagcgtgccgagctctcagaaggccaagtccgacagctggaagaacaattaagaattatg
gatcagactttgaaagcattaatggctgcagaggataagtactcacaaaaggaagacaaa
tatgaagaggaaatcaaggttctttctgacaaactgaaagaggctgagactcgggctgaa
tttgctgagaggtcagtaaccaaattggaaaagagcattgatgacttagaagagaaagtg
gcacatgccaaagaagaaaaccttagtatgcatcagatgctggatcagactttactggag
ttaaacaacatgtga

DBGET integrated database retrieval system