KEGG   Monodelphis domestica (opossum): 100016743Help
Entry
100016743         CDS       T01031                                 

Gene name
KAT5
Definition
K(lysine) acetyltransferase 5
Orthology
K11304  
histone acetyltransferase HTATIP [EC:2.3.1.48]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
HTLV-I infection
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Human Diseases
  Infectious diseases
   05166 HTLV-I infection
    100016743 (KAT5)
Enzymes [BR:mdo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100016743 (KAT5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 608 aa AA seqDB search
MRRRGARPRPDSGPGPRSKRSSACSPGGRTPLPAFIFAVRAAPATSGSRHFLARSGPPRG
LQTLTPLQLESGRLQHAGRDVTSRSRKRLLREGGKMAEVGEVIEGCRLPVLRRNQDNEDE
WPLAEILSVKDISGRKLFYVHYIDFNKRLDEWVTHDRLDLKKIQFPKKEAKTPTKNGLPG
SRPGSPEREVPASAQASGKTLPIPVQITLRFNLPKEREAIPGGEPDQPLSSSSCLQPNHR
STKRKVEVVSPATPVPSETAPASVFPQNGSTRRALAAQPGRKRKSNCLGTDEDSQDSSDG
IPSAPRMTGSLVSDRSHDDIVTRMKNIECIELGRHRLKPWYFSPYPQELTALPVLYLCEF
CLKYGKSLKCLQRHLTKCDLRHPPGNEIYRKGTISFFEIDGRKNKSYSQNLCLLAKCFLD
HKTLYYDTDPFLFYVMTEYDCKGFHIVGYFSKEKESTEDYNVACILTLPPYQRRGYGKLL
IEFSYELSKVEGKTGTPEKPLSDLGLLSYRSYWSQTILEILMGLKSESGERPQITINEIS
EITSIKKEDVISTLQYLNLINYYKGQYILTLSEDIVDGHERAMLKRLLRIDSKCLHFTPK
DWSKRGKW
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgagaaggcgaggagctaggccccgccctgattccggcccggggcctcgaagtaaacgc
tcctctgcctgctcgcccggaggccgaacgccactgccggcgtttattttcgccgttcga
gccgcacccgccacaagcggctcccgacatttcttggcccggtccggccctcccagaggc
ctccagaccctcacacccctgcagctagaatccgggaggctccagcacgccggacgtgac
gtcacctcacggagccggaagcggctcctgagggagggagggaagatggcggaggtgggc
gaggtcatcgagggttgccgcttgcccgtgctgcggcgtaaccaggacaacgaggatgag
tggcctctggcagagatcctgagtgtgaaggacatcagtgggcggaagcttttctacgtc
cattacattgacttcaacaagcgcctagatgagtgggtgacccatgacaggctggaccta
aagaaaatccagtttcccaagaaagaggccaagacccccaccaaaaatgggctccctggg
tccagaccgggctcccctgaaagggaggtgccggcttcggcccaggccagtgggaagaca
ctgccgatcccggtgcagatcacgctccgcttcaacctacccaaggagcgcgaggccatc
cccggcggcgagcctgaccagcccctctcctccagctcctgcctgcaacccaaccaccgt
tccacgaaaagaaaagtggaagtggtttctccagcaactcccgtgcccagcgagacggca
ccggcttctgtttttcctcagaacggctcaacccggagggccctggcagcccagccggga
cggaagagaaagtctaactgtttaggcaccgatgaggactcccaggacagctcagacgga
atcccgtcagcccctcgcatgaccggcagcttggtgtccgaccggagccacgacgacatc
gtcacccgcatgaagaacatcgagtgcatcgagcttggccggcaccgcctcaagccctgg
tacttctccccgtacccccaggagctgaccgctctgcctgtgctctatctctgcgagttc
tgtctgaagtatggaaaaagcctcaagtgtctacagcgccacctgaccaaatgtgacctg
cgccatcccccaggcaatgagatttaccgaaagggcaccatttccttctttgaaattgat
gggcgtaagaacaagagttactcccagaacctctgtcttttggccaagtgtttcctggac
cacaagaccctgtattacgacacagaccccttcctcttctatgtcatgaccgagtacgac
tgcaagggcttccacatcgtcggctacttttccaaggaaaaagagtccaccgaggattac
aatgtggcctgcattctgactctacctccctaccagcgccgtggctatggcaagctgctc
attgagttcagctatgagttgtctaaggtggaagggaaaacggggacacccgagaagccc
ctctcggacctcggccttctgtcctatcgcagctactggtcccagaccatcctggagatc
ctcatgggcctgaagtcagagagcggggagaggccccagattacaatcaatgagatcagt
gagatcaccagcatcaagaaggaagatgtcatctcgacgctacagtacctcaatctcatt
aactactacaagggccagtacatcctgacgctgtctgaggacatcgtggacggccacgag
cgtgccatgctcaaacggcttttgcgcattgactccaagtgtctacacttcacaccaaag
gactggagcaaacggggaaagtggtga

DBGET integrated database retrieval system