KEGG   Monodelphis domestica (opossum): 100016853Help
Entry
100016853         CDS       T01031                                 

Definition
(RefSeq) prostaglandin G/H synthase 1-like
  KO
K00509  
prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Platelet activation
Serotonergic synapse
Regulation of lipolysis in adipocytes
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100016853
 Organismal Systems
  Immune system
   04611 Platelet activation
    100016853
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    100016853
  Nervous system
   04726 Serotonergic synapse
    100016853
Enzymes [BR:mdo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     100016853
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 564 aa AA seqDB search
MYSTPETSAKVNPCCYYPCQNKGICIHFELDQYHCDCTRTGYYGPNCTTPLLWTKISKHL
YPSHSFVHFLLTHASWIWKLINATFLRDVLMRLIITSRTNLIPSPHIYNSYHNYMNWESY
SNLSYYSRVLPPVPEDCPTPMGVKGKKQLPDPEVLVTNFLIRKKFVPDPQGTNLMFAFFA
QHFTHQFFKTSLKLGSAFTSALGHGVDLSNVYGDNLKRQYQLRLFKDGKLKFQMVDGEMY
PPSVAETQASMNYPPTVPKVYQMAVGNEQFGLLPGLMMYATLWLREHNRVCDILKSEHPT
WKDEQLFQTARLILIGETIKIVIEEYVQHLSGYYLKLKFDPEMLFGVPFQYQNRISLEFN
HLYHWHPLIPDVFVVGDKEYNYKQFVFNTSMLLDYGVETLVNDFSSQRAGKIAGINNVNH
NLRTVAENTIRVSRRLKFQSFNEYRKRFGLKPYTSFQELTGENEKSAELEKLYGDIDAVE
FYPGLLLEKSLPNSSLGESIVNIGSSFSLKGLLSNPICSPEYWKPSTFGGQVGFNLVKTA
TLQKLVCLNVKKCPYVSFRVPEGK
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgtattctactccagaaacctctgctaaagtgaatccctgctgctattacccatgtcaa
aacaaaggtatctgtatacattttgaactagaccagtaccattgtgattgtaccagaact
ggctactatgggcccaattgcaccacgccattgctatggacgaagatttcaaaacaccta
tatcctagccattccttcgtccacttcctcctgacccacgctagctggatctggaagttg
atcaacgctaccttcctccgagatgttcttatgaggcttattattacaagtcgaacaaac
ctgattcctagcccacacatctacaactcataccataactacatgaactgggagtcctat
tccaatttgagctactattcccgagtcctaccccctgtacctgaagactgtcctaccccc
atgggggtcaaagggaagaaacagctgccagacccagaggtgctggtcacaaatttcctg
atccggaaaaagtttgtgcccgatcctcaagggaccaatctcatgtttgccttctttgcc
caacacttcacccatcagttcttcaagacatctttaaagttggggtctgccttcaccagt
gccctgggccatggggtagacctcagtaatgtttatggagacaacctgaagcgccagtac
cagctacgcctttttaaggatgggaagctcaagtttcagatggtggatggggagatgtat
ccaccatcagtggctgagactcaagcatccatgaattatccaccaactgtacctaaagtt
taccagatggctgtgggaaatgagcagtttgggttgctcccaggcctcatgatgtatgct
acactctggcttcgggagcacaaccgtgtctgtgacatcttgaaatcggagcatcccact
tggaaagatgagcagctctttcagacagcccgactcatcctcataggggagaccatcaag
attgtcattgaagaatatgtgcagcaccttagtggctattacttgaagctgaaatttgac
cccgaaatgctgtttggagtcccgtttcagtatcaaaaccgtatctccttggagtttaac
catctgtaccactggcacccactcatacctgacgtttttgtggtgggagacaaggaatac
aattataagcagtttgtattcaacacctccatgcttttggactatggtgtagagaccctg
gtgaatgatttctccagccagcgggcaggcaagattgctgggatcaataacgtcaaccat
aatttgaggactgtggctgagaacaccattcgtgtatcacgtcgcctgaagtttcagtct
ttcaatgaataccgcaaacgatttggcttgaaaccctacacctcctttcaagagctcaca
ggagaaaatgagaaatcagcagaactggagaagttgtatggagacattgatgctgtggag
ttctacccaggtttacttctagagaaatctctgcccaattctagcctaggggagagcatt
gtgaatattggatcctctttctccctcaaggggctcctgtcaaaccctatctgttctcct
gagtactggaagcccagtacatttggtggtcaggttggctttaaccttgtcaagacagcc
accttgcagaagcttgtttgtctcaatgtcaaaaagtgcccctatgtatcattccgtgtg
cctgaaggcaagtaa

DBGET integrated database retrieval system