KEGG   Monodelphis domestica (opossum): 100016853Help
Entry
100016853         CDS       T01031                                 

Definition
prostaglandin G/H synthase 1-like
Orthology
K00509  
prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Platelet activation
Serotonergic synapse
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100016853
 Organismal Systems
  Immune system
   04611 Platelet activation
    100016853
  Nervous system
   04726 Serotonergic synapse
    100016853
Enzymes [BR:mdo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     100016853
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 564 aa AA seqDB search
MYSTPETSAKVNPCCYYPCQNKGICIHFELDQYHCDCTRTGYYGPNCTTPLLWTKISKHL
YPSHSFVHFLLTHASWIWKLINATFLRDVLMRLIITSRTNLIPSPHIYNSYHNYMNWESY
SNLSYYSRVLPPVPEDCPTPMGVKGKKQLPDPEVLVTNFLIRKKFVPDPQGTNLMFAFFA
QHFTHQFFKTSLKLGSAFTSALGHGVDLSNVYGDNLKRQYQLRLFKDGKLKFQMVDGEMY
PPSVAETQASMNYPPTVPKVYQMAVGNEQFGLLPGLMMYATLWLREHNRVCDILKSEHPT
WKDEQLFQTARLILIGETIKIVIEEYVQHLSGYYLKLKFDPEMLFGVPFQYQNRISLEFN
HLYHWHPLIPDVFVVGDKEYNYKQFVFNTSMLLDYGVETLVNDFSSQRAGKIAGINNVNH
NLRTVAENTIRVSRRLKFQSFNEYRKRFGLKPYTSFQELTGENEKSAELEKLYGDIDAVE
FYPGLLLEKSLPNSSLGESIVNIGSSFSLKGLLSNPICSPEYWKPSTFGGQVGFNLVKTA
TLQKLVCLNVKKCPYVSFRVPEGK
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgtattctactccagaaacctctgctaaagtgaatccctgctgctattacccatgtcaa
aacaaaggtatctgtatacattttgaactagaccagtaccattgtgattgtaccagaact
ggctactatgggcccaattgcaccacgccattgctatggacgaagatttcaaaacaccta
tatcctagccattccttcgtccacttcctcctgacccacgctagctggatctggaagttg
atcaacgctaccttcctccgagatgttcttatgaggcttattattacaagtcgaacaaac
ctgattcctagcccacacatctacaactcataccataactacatgaactgggagtcctat
tccaatttgagctactattcccgagtcctaccccctgtacctgaagactgtcctaccccc
atgggggtcaaagggaagaaacagctgccagacccagaggtgctggtcacaaatttcctg
atccggaaaaagtttgtgcccgatcctcaagggaccaatctcatgtttgccttctttgcc
caacacttcacccatcagttcttcaagacatctttaaagttggggtctgccttcaccagt
gccctgggccatggggtagacctcagtaatgtttatggagacaacctgaagcgccagtac
cagctacgcctttttaaggatgggaagctcaagtttcagatggtggatggggagatgtat
ccaccatcagtggctgagactcaagcatccatgaattatccaccaactgtacctaaagtt
taccagatggctgtgggaaatgagcagtttgggttgctcccaggcctcatgatgtatgct
acactctggcttcgggagcacaaccgtgtctgtgacatcttgaaatcggagcatcccact
tggaaagatgagcagctctttcagacagcccgactcatcctcataggggagaccatcaag
attgtcattgaagaatatgtgcagcaccttagtggctattacttgaagctgaaatttgac
cccgaaatgctgtttggagtcccgtttcagtatcaaaaccgtatctccttggagtttaac
catctgtaccactggcacccactcatacctgacgtttttgtggtgggagacaaggaatac
aattataagcagtttgtattcaacacctccatgcttttggactatggtgtagagaccctg
gtgaatgatttctccagccagcgggcaggcaagattgctgggatcaataacgtcaaccat
aatttgaggactgtggctgagaacaccattcgtgtatcacgtcgcctgaagtttcagtct
ttcaatgaataccgcaaacgatttggcttgaaaccctacacctcctttcaagagctcaca
ggagaaaatgagaaatcagcagaactggagaagttgtatggagacattgatgctgtggag
ttctacccaggtttacttctagagaaatctctgcccaattctagcctaggggagagcatt
gtgaatattggatcctctttctccctcaaggggctcctgtcaaaccctatctgttctcct
gagtactggaagcccagtacatttggtggtcaggttggctttaaccttgtcaagacagcc
accttgcagaagcttgtttgtctcaatgtcaaaaagtgcccctatgtatcattccgtgtg
cctgaaggcaagtaa

DBGET integrated database retrieval system