KEGG   Monodelphis domestica (opossum): 100016872Help
Entry
100016872         CDS       T01031                                 

Definition
dual specificity mitogen-activated protein kinase kinase 3-like
Orthology
K04432  
mitogen-activated protein kinase kinase 3 [EC:2.7.12.2]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
MAPK signaling pathway
Rap1 signaling pathway
Toll-like receptor signaling pathway
Fc epsilon RI signaling pathway
TNF signaling pathway
Inflammatory mediator regulation of TRP channels
GnRH signaling pathway
Amyotrophic lateral sclerosis (ALS)
Toxoplasmosis
Influenza A
Epstein-Barr virus infection
Class
Environmental Information Processing; Signal transduction; Rap1 signaling pathway [PATH:mdo04015]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:mdo04010]
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:mdo04668]
Organismal Systems; Immune system; Toll-like receptor signaling pathway [PATH:mdo04620]
Organismal Systems; Immune system; Fc epsilon RI signaling pathway [PATH:mdo04664]
Organismal Systems; Endocrine system; GnRH signaling pathway [PATH:mdo04912]
Organismal Systems; Sensory system; Inflammatory mediator regulation of TRP channels [PATH:mdo04750]
Human Diseases; Neurodegenerative diseases; Amyotrophic lateral sclerosis (ALS) [PATH:mdo05014]
Human Diseases; Infectious diseases; Influenza A [PATH:mdo05164]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:mdo05169]
Human Diseases; Infectious diseases; Toxoplasmosis [PATH:mdo05145]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 413 aa AA seqDB search
MNPSFNLSGFMVTLTSQSGFGAALSRRTSSPFLHPIAPPLSIRIPPAPEGRGWRSSSLQP
PAAALSGSRPRASSLSMSLSRGKIKNRKDLKISCVSNKPPVSNPTPPRNLDSRTFITIGD
KNFEVAADDLVSISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNTQEQKRLLMDLDIS
MRTVDCFYTVTFYGALFREGDVWICMELMDTSLDKFYKKVLEKQMTIPEDILGEIAVSIV
RALEHLHSKLSVIHRDVKPSNVLINKQGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPE
RINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRF
SPEFVDFTAQCLRKNPAERMSYLQLMEHPFFTLHKTKETDIAAFVKEILGEDS
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaatcccagtttcaacttgagtggcttcatggtcaccttgacttctcagtctggcttc
ggcgccgccctcagccgtcgaactagctcgcctttcctgcatcccatcgccccaccgctc
tcaatccgaatccctccagcccccgagggccgggggtggagatcctccagcctccaacct
ccagccgccgccctcagcggatcccggccccgcgcctccagtctcagcatgtccctctcc
agaggaaaaatcaagaacaggaaggatttaaaaatatcatgcgtctccaacaagcctcct
gtctccaatccaacacctcccaggaacctggactctaggaccttcattacaattggtgac
aagaactttgaagtggcagctgatgatttagtgtccatttcagagctgggtcgaggtgcc
tatggggtagtggagaaagttcgacatgctcagagtggaaccatcatggctgtcaagaga
atccgagcgactgtgaacactcaggaacagaagcggcttctcatggatctggatatctcc
atgaggactgttgactgcttctatactgtcaccttctatggggcgcttttcagagagggt
gacgtatggatctgtatggaattgatggacacctccctggacaaattttacaagaaggtt
ctggagaagcagatgaccataccagaggatattctaggcgagatagcagtgtctattgtt
agagccctggagcacttacatagtaaactttctgtgatacacagagatgtcaagccatcc
aatgttcttatcaacaagcaaggccatgttaaaatgtgtgactttggcatcagtggctac
ttggtggactcagttgccaagaccatggatgctggttgcaaaccctatatggcgccagag
agaatcaacccagaactgaaccaaaaaggatataatgtcaagtcagacgtctggagtctg
ggaatcactatgattgagatggccattcttcggtttccgtatgagtcatgggggacccca
ttccagcagctgaaacaggtggtagaagaaccttctccccagcttcctgctgaccgcttc
tctcccgagtttgtggacttcacagctcagtgcttgaggaagaatcctgcagagcgaatg
agttatctgcagctaatggagcatcctttctttactttgcacaaaaccaaagagacagac
atcgccgcctttgtgaaggagattctgggcgaggactcgtag

DBGET integrated database retrieval system