KEGG   Monodelphis domestica (opossum): 100016872Help
Entry
100016872         CDS       T01031                                 

Gene name
MAP2K3
Definition
(RefSeq) mitogen-activated protein kinase kinase 3
  KO
K04432  mitogen-activated protein kinase kinase 3 [EC:2.7.12.2]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo04010  MAPK signaling pathway
mdo04015  Rap1 signaling pathway
mdo04218  Cellular senescence
mdo04620  Toll-like receptor signaling pathway
mdo04664  Fc epsilon RI signaling pathway
mdo04668  TNF signaling pathway
mdo04714  Thermogenesis
mdo04750  Inflammatory mediator regulation of TRP channels
mdo04912  GnRH signaling pathway
mdo05014  Amyotrophic lateral sclerosis (ALS)
mdo05145  Toxoplasmosis
mdo05164  Influenza A
mdo05169  Epstein-Barr virus infection
Module
mdo_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100016872 (MAP2K3)
   04010 MAPK signaling pathway
    100016872 (MAP2K3)
   04668 TNF signaling pathway
    100016872 (MAP2K3)
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    100016872 (MAP2K3)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    100016872 (MAP2K3)
   04664 Fc epsilon RI signaling pathway
    100016872 (MAP2K3)
  Endocrine system
   04912 GnRH signaling pathway
    100016872 (MAP2K3)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100016872 (MAP2K3)
  Environmental adaptation
   04714 Thermogenesis
    100016872 (MAP2K3)
 Human Diseases
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    100016872 (MAP2K3)
  Infectious diseases
   05164 Influenza A
    100016872 (MAP2K3)
   05169 Epstein-Barr virus infection
    100016872 (MAP2K3)
   05145 Toxoplasmosis
    100016872 (MAP2K3)
Enzymes [BR:mdo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     100016872 (MAP2K3)
Protein kinases [BR:mdo01001]
 Serine/threonine kinases: STE group
  STE7 family
   100016872 (MAP2K3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase Seadorna_VP7 APH Choline_kinase DHR-2 DUF4344 RIO1
Motif
Other DBs
NCBI-GeneID: 100016872
NCBI-ProteinID: XP_007498514
Ensembl: ENSMODG00000001404
Position
6
AA seq 337 aa AA seqDB search
MDKRQGKIKNRKDLKISCVSNKPPVSNPTPPRNLDSRTFITIGDKNFEVAADDLVSISEL
GRGAYGVVEKVRHAQSGTIMAVKRIRATVNTQEQKRLLMDLDISMRTVDCFYTVTFYGAL
FREGDVWICMELMDTSLDKFYKKVLEKQMTIPEDILGEIAVSIVRALEHLHSKLSVIHRD
VKPSNVLINKQGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYNVKSD
VWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVDFTAQCLRKNP
AERMSYLQLMEHPFFTLHKTKETDIAAFVKEILGEDS
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggacaaaaggcaaggaaaaatcaagaacaggaaggatttaaaaatatcatgcgtctcc
aacaagcctcctgtctccaatccaacacctcccaggaacctggactctaggaccttcatt
acaattggtgacaagaactttgaagtggcagctgatgatttagtgtccatttcagagctg
ggtcgaggtgcctatggggtagtggagaaagttcgacatgctcagagtggaaccatcatg
gctgtcaagagaatccgagcgactgtgaacactcaggaacagaagcggcttctcatggat
ctggatatctccatgaggactgttgactgcttctatactgtcaccttctatggggcgctt
ttcagagagggtgacgtatggatctgtatggaattgatggacacctccctggacaaattt
tacaagaaggttctggagaagcagatgaccataccagaggatattctaggcgagatagca
gtgtctattgttagagccctggagcacttacatagtaaactttctgtgatacacagagat
gtcaagccatccaatgttcttatcaacaagcaaggccatgttaaaatgtgtgactttggc
atcagtggctacttggtggactcagttgccaagaccatggatgctggttgcaaaccctat
atggcgccagagagaatcaacccagaactgaaccaaaaaggatataatgtcaagtcagac
gtctggagtctgggaatcactatgattgagatggccattcttcggtttccgtatgagtca
tgggggaccccattccagcagctgaaacaggtggtagaagaaccttctccccagcttcct
gctgaccgcttctctcccgagtttgtggacttcacagctcagtgcttgaggaagaatcct
gcagagcgaatgagttatctgcagctaatggagcatcctttctttactttgcacaaaacc
aaagagacagacatcgccgcctttgtgaaggagattctgggcgaggactcgtag

DBGET integrated database retrieval system