KEGG   Monodelphis domestica (opossum): 100016917Help
Entry
100016917         CDS       T01031                                 

Gene name
CLK2
Definition
(RefSeq) CDC like kinase 2
  KO
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
mdo  Monodelphis domestica (opossum)
Brite
Enzymes [BR:mdo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100016917 (CLK2)
Protein kinases [BR:mdo01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   100016917 (CLK2)
Spliceosome [BR:mdo03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100016917 (CLK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 526 aa AA seqDB search
MPHPRRYRSSERGSRGSYHEHYRSRKHKRRRSRSWSSSSDRTRRRRREDSYHVRSRSYDD
HSSDRRAYDRRYCGSYRRDYSRERGEPYYEAEYRHSYEYHRDDSYRSQRSSRRKHRRRRR
HSRTFSHSSSVSSQHCLLSPFFFRIPRILGKVSPFCHLSPGQHAHLLPTKLTPLSLSFPL
PIPFCTISDEIVSTLGEGTFGRVVQCVDHRRGGARVALKIIKNVEKYKEAARLEINVLEK
INEKDPDNKNLCVQMFDWFDYHGHMCISFELLGLSTFDFLKDNNYLPYPIHQVRHMAFQL
CQAVKFLHDNKLTHTDLKPENILFVNSDYELTYNLEKKRDERSVKNTAVRVVDFGSATFD
HEHHSTIVSTRHYRAPEVILELGWTQPCDVWSIGCIIFEYYVGFTLFQTHDNREHLAMME
RILGPIPSRMIRKTRKQKYFYRGRLDWDENTSAGRYVRENCKPLRRYLTSEADEHHQLFD
LIESMLEYEPAKRLTLGEALQHPFFARLRAEPPNAKVWDSSRDISR
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atgcctcacccccgcagataccgctcttcagagcggggcagcaggggcagctaccatgaa
cactaccgaagtcgaaaacataagcgccggagaagccgctcttggtccagcagcagtgac
cggactcggcggcgccggcgggaagacagctaccatgtccgctctagaagctatgatgac
cactcttctgaccggcgggcttatgaccgacgatactgtggcagctataggcgtgactac
agccgggaacgaggggaaccttactatgaagctgagtatcgacattcctatgagtaccat
cgggatgacagctaccgtagccaacgaagtagccgtaggaaacataggcggcggagacga
catagccggacattcagccattcatcctcggtgagtagtcaacactgtcttctctcccca
ttcttctttaggattcctaggattctgggtaaggtatcccccttctgtcatctatcccca
ggtcagcatgcccatcttttaccaactaagctcaccccattatctctctccttccctctc
cccatcccattctgtaccatttcagatgagattgtgagcactctaggagaagggaccttt
ggccgtgttgtgcagtgtgtggatcatcgaaggggtggagctcgagttgccctaaagatc
attaagaatgtggaaaagtacaaagaggcagcacgactggaaatcaatgtgttggagaag
atcaatgaaaaggatccagacaataagaacctgtgtgtccagatgtttgactggtttgac
taccatggccatatgtgtatctccttcgagctcctgggcctcagcactttcgacttcctc
aaagacaacaactacctgccctaccccatccaccaagtgcgccacatggccttccagctg
tgtcaggccgtcaagttcctccatgacaacaagctgacacatacggacctcaagccagaa
aacatcctgtttgtgaattcggactatgagctcacctacaacctggagaagaaacgggat
gaacggagtgtgaagaacactgcagtacgggtagtggattttggcagtgccacttttgat
catgaacatcatagtaccattgtttctactcgacattaccgagctccagaggtcatcttg
gagctcggctggacacagccctgtgacgtatggagcatcggctgcatcatcttcgagtac
tacgttggcttcaccctgttccagactcatgacaaccgagaacacttagcaatgatggag
aggattcttgggcccattccctctcgaatgatccgaaagaccaggaagcagaagtatttt
taccggggtcgcctggattgggatgaaaacacatcggctggccgttatgtacgagagaat
tgcaaacctctgcggcgatacctgacatcggaggcagatgaacaccaccagctatttgac
ctgattgaaagcatgctagagtatgaacctgccaagcgactgaccctgggcgaagccctg
caacatcctttctttgcccgccttagggctgaaccaccaaacgctaaggtgtgggactcc
agtcgagatatcagccggtga

DBGET integrated database retrieval system