KEGG   Monodelphis domestica (opossum): 100016993Help
Entry
100016993         CDS       T01031                                 

Gene name
USP3
Definition
ubiquitin specific peptidase 3
Orthology
K11986  
ubiquitin carboxyl-terminal hydrolase 3 [EC:3.1.2.15]
Organism
mdo  Monodelphis domestica (opossum)
Brite
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100016993 (USP3)
Peptidases [BR:mdo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100016993 (USP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 520 aa AA seqDB search
MECPHLSSSVCIVPDSAKFPNGSPSSWCCSVCRSNKSPWVCLTCSSVHCGRYVNGHAKKH
YEDAQISLTNHKKTEKQEKVQHTVCMDCSSYSTYCYRCDDFVVNDTKLGLVQKVREHLQN
LENSAFTADRHRKRKLLENSSLNSKLLKVNGSTTALCATGLRNLGNTCFMNAILQSLSNI
QQFCCYFKELPAVELRNGKTAGRRTYHTRSQGDNNVSLVEEFRKTLCALWQGSQTAFSPE
SLFYVVWKIMPNFRGYQQQDAHEFMRYLLDHLHLELQGGFNGVSRSVILQENSSLSASNK
CCINGASTVVTAIFGGILQNEVNCLICGTESRKFDPFLDLSLDIPSQFRNKRSKNQENGP
LCSLRDCLRSFTDLEELDETELYMCHKCKKKQKSTKKFWIQKLPKVLCLHLKRFHWTAYL
RNKVDTYVEFPLRGLDMKCYLLEPENSGPESCLYDLAAVVVHHGSGVGSGHYTAYATHEG
RWFHFNDSTVTLTDEETVVKAKAYILFYVERQARSGSEKL
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atggagtgccctcacctcagctccagcgtctgcatcgtcccggactcggccaagttcccc
aacggctccccgtcatcctggtgctgcagcgtgtgccggtccaacaaaagcccctgggtc
tgtttgacttgttcaagtgtccattgtggaaggtatgtgaatggtcatgcaaaaaaacat
tatgaagatgcacagatttccttaaccaaccataagaaaacagaaaaacaagagaaagtt
caacacactgtgtgcatggattgcagtagttacagtacatactgttatcgctgtgatgat
tttgtggtaaatgataccaagctgggactggtacagaaagtcagagaacacttacagaac
ttggaaaattcagcctttacagcggacagacataggaaaaggaaacttttggaaaactca
tctctaaacagcaagttgttaaaagtaaatggaagtaccactgccctttgtgctactggc
cttcggaatttggggaacacatgttttatgaatgctattcttcagtcactcagtaatatt
cagcagttttgctgttatttcaaagaacttccagctgtggaattacggaatgggaaaaca
gcaggaaggcggacttatcacaccaggagccaaggagataacaatgtttccttggtagaa
gagtttagaaaaacactgtgtgctttatggcaaggcagccaaactgcatttagcccagaa
tccttattttatgttgtttggaaaatcatgccaaattttaggggttatcagcagcaggat
gcccatgaatttatgcgctatcttttggaccatctacacttggaactccagggaggcttc
aatggtgtttctcgatcagtaattctgcaagagaattctagtctttctgcaagtaacaaa
tgttgcataaatggagcttctacagttgtcacagctatattcggaggcattcttcaaaat
gaagttaactgcttaatatgtgggacagaatctagaaagtttgatccatttcttgacctt
tcgttagatattccaagtcagttcaggaacaagcgttctaagaaccaagaaaatgggcca
ttgtgttcacttcgagattgtcttcgtagttttacagacttggaagaacttgatgaaaca
gaactgtatatgtgccacaaatgcaaaaagaaacagaaatccaccaaaaaattttggatt
caaaaattaccaaaggtgctatgcttacatttgaagaggtttcattggacagcatatcta
agaaacaaggttgatacatatgtagaatttcccctgagaggcctagacatgaaatgctac
ttattggagcctgagaatagtggtccagaaagctgtctctatgaccttgccgcagttgtt
gtgcatcatggttcaggtgttggttctggacattacacagcttatgcaactcatgaaggt
cgctggtttcattttaatgacagcaccgtaacactgaccgatgaggagactgtggtaaag
gccaaggcctacatcctcttctacgtggaacgccaggcccgatctggctctgagaaactc
tga

DBGET integrated database retrieval system