KEGG   Monodelphis domestica (opossum): 100017048Help
Entry
100017048         CDS       T01031                                 

Definition
renin-like
Orthology
K01380  
renin [EC:3.4.23.15]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Organismal Systems
  Endocrine system
   04614 Renin-angiotensin system
    100017048
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.15  renin
     100017048
Peptidases [BR:mdo01002]
 Aspartic Peptidases
  Family A1: pepsin family
   100017048
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
2
AA seq 389 aa AA seqDB search
MDCWELLLVAWLICFFSLPSDGLQRIALKKMISVKESMKMRGKHLENLNMAENSWHGVVS
PIILTNYEDTQYYGEINIGSPPQTFKVVFDTGSSDFWVPSSQCDPLYTACEFHNRYDASK
SSTYKMNGSNFIIHYASGRVKGFLSQDILTIGEIKVTQVFGEVTALPLIPFGLAWFDGIL
GLGYPKRSMSGITPVFDNIMAEGVLKEDVFSIYYSRSSGKNGGELILGGSDPNYYQGTFH
YINTSRPHFWQIQMQGVAVKSYVLSCEDGCPAVVDTGTSFITGPTDSIRGLMTAIGAEED
GGEYLVKCDLASTLPDISFNFDGKDFTLQGSDYVLEDENQSDQMCLVAINGLDVSPPTGP
LWVLGATFIRKFYVEFDRHNNRIGFALAA
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggattgctgggagctcctgctggtagcctggctcatttgcttcttcagtctgcccagt
gatggcttacaaaggattgccctcaagaaaatgatctcagtcaaagagagcatgaagatg
aggggcaagcacttggagaacttgaacatggcagagaactcttggcatggtgtagtatcc
cctatcattctcaccaattatgaggatacccagtattatggtgagatcaatattggcagc
ccaccccaaaccttcaaagtcgtttttgacactggatcttctgacttttgggtgccctct
agccaatgtgacccactctatacagcctgtgagtttcacaatcgatatgatgcctcaaaa
tcctctacttacaaaatgaatggatcaaacttcatcatccactatgcatctggtcgggtc
aagggcttcctgagtcaagatatactgactattggtgaaatcaaggtgactcaggtattt
ggtgaggtcacagcactgcccctgataccctttggactggcctggttcgatggaatcctt
ggcctgggataccctaagaggtcaatgagtggaatcacgcctgtctttgacaacataatg
gcagaaggggtgctgaaggaagatgtcttctctatctattacagcaggagttcggggaag
aatggtggagagctgatacttggaggcagtgaccccaactattaccaagggacctttcac
tacatcaacaccagccggccacacttctggcagatccagatgcaaggggtggctgtcaag
tcttatgtgctgtcctgtgaggatggttgccctgcagttgtggacacaggaacatccttc
atcacaggcccaaccgattccataagaggactgatgacggcaattggagctgaggaagat
gggggagagtatcttgtaaaatgtgacctggcatccacgctcccagatatctcattcaac
tttgatggcaaagatttcacactccaaggttctgactatgtcttagaggatgaaaaccag
agtgatcagatgtgccttgtggccatcaatggtctggatgtctcaccaccaacaggacct
ctttgggtccttggagcaactttcatccgaaagttttatgttgaatttgaccggcacaac
aatcgcattggttttgccttggcagcctga

DBGET integrated database retrieval system