KEGG   Monodelphis domestica (opossum): 100017232Help
Entry
100017232         CDS       T01031                                 

Definition
ubiquitin carboxyl-terminal hydrolase 22-A-like
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
mdo  Monodelphis domestica (opossum)
Brite
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100017232
Peptidases [BR:mdo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100017232
Transcription machinery [BR:mdo03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100017232
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 523 aa AA seqDB search
MSPAGCSHVNSFKVENWRQNLRVIYQCFVWSGTPETRKRKAKSCICHMCGAHLNRLHSCL
YCVFFGCFTKKHIHEHAKTKRHNLAIDLLYGGIYCFMCQDYIYDKDMEQIAKEEQRKAWK
LQAFTPTVVSHYQCTMTGIGEKYSTWEPTKRELELLRHNPKRRKITTNCTIGLRGLINLG
NTCFMNCIVQALTHTPLLRDFFLSDRHKCEMQSPSSCLVCEMSTLFQEFYSGHRSPHIPY
RLLHLVWTHARHLAGYEQQDAHEFLIAALDVLHRHCKGDDNGKKANNPNHCNCIIDQIFT
GGLQSDVTCQVCHGVSTTIDPFWDISLDLPGSSTPFWPLSPGSDGSVVNGESHVSGTTTL
TDCLRRFTRPEHLGSSAKIKCSGCHSYQESTKQLTMKKLPIVACFHLKRFEHSAKLRRKI
TTYVSFPLELDMTPFMASSKESRMNGQYQQPTDSLNNDNKYSLFAVVNHQGTLESGHYTS
FIRQHKDQWFKCDDAIITKASIKDVLDSEGYLLFYHKQFLEYE
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgagtccggccggctgctcgcatgtgaacagctttaaggtggagaactggcggcagaac
ctgcgggtcatctaccagtgcttcgtgtggagcgggacccctgagaccaggaagcgcaag
gcaaagtcgtgcatctgtcatatgtgtggcgcccacttaaatagactccactcttgcctc
tactgtgtcttctttggctgttttacaaagaaacatattcacgagcacgcaaagacaaag
cgacacaacttggccatagaccttttgtatgggggtatatactgctttatgtgtcaggat
tacatatacgacaaagacatggaacaaattgccaaagaagaacaacggaaagcttggaaa
ttacaagccttcaccccaacagtggtttctcactaccagtgtacaatgacaggaattgga
gagaagtattcaacttgggagccaaccaaacgagaactagaattgcttcgacataatcct
aagcggagaaaaataaccacaaattgtaccataggtctacgagggctaatcaatcttggg
aacacgtgttttatgaactgtattgtccaagcacttacccacactccactactgcgagat
ttcttcctctctgacaggcacaaatgtgaaatgcaaagtcccagctcatgtctggtttgt
gaaatgtctacgctttttcaggagttttactctgggcaccgatctcctcacattccatat
aggttactgcacctggtatggacgcatgcacgacatttagcagggtacgagcaacaggat
gcacacgagttcctcattgctgcattagatgtgctgcacagacactgcaaaggtgacgat
aatgggaaaaaggccaacaaccctaaccactgtaattgtatcatcgaccaaatcttcaca
ggtggactgcagtcggatgtcacctgtcaagtttgccatggcgtttctacaacgatagac
ccattctgggacatcagtttagacttgcctggttcttcaactccattctggccacttagt
ccagggagtgatggcagcgtggtaaatggggaaagccatgtatccggaaccaccacactc
acagactgcttgcgaaggtttacaaggccagagcacttaggaagcagtgccaaaatcaaa
tgtagtggttgccatagctaccaggaatccaccaaacaactcactatgaagaaattaccc
attgtggcctgttttcatctcaaacggtttgaacactcagccaaactgaggcgaaagatc
actacgtatgtctccttccccttggagctggacatgacaccatttatggcctccagtaaa
gagagcagaatgaatggacagtaccagcagccaacggatagtctaaacaatgataataag
tattccttgtttgcagtagttaatcaccaaggaaccttggagagtgggcactataccagc
ttcattcgacaacacaaggaccagtggttcaaatgtgatgatgccatcatcactaaggct
agcattaaggatgttctagacagtgaagggtacttactgttctatcacaaacaattcctg
gagtatgagtag

DBGET integrated database retrieval system