KEGG   Monodelphis domestica (opossum): 100017232Help
Entry
100017232         CDS       T01031                                 

Definition
ubiquitin carboxyl-terminal hydrolase 22-A-like
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
mdo  Monodelphis domestica (opossum)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 880 aa AA seqDB search
MPLLKSSENKSVRDIYSSSLNPKWRNAINFRFEGDGTCRRSPNSSEKNVYCVCTGVRARA
RTKDVLPPRVPAPKSLRQRSQVTWCLRPSVTFPPPPPRQSARETYIYVILVPLLIGAGGD
PGKDPGKFRPGVKNRCIPENLGCRENGPINSAPRSQTCVFKTGRRAKIQNEMAGHCQHAF
MHLVLLPTWSSSREPKGLGCYGTGNHWGNREKLKGEADMTAALLLQPSLQRAGSATRWKV
TVSQSPTLTRLPCLGRRALFRVAFASGREGAGDPPPGLCAPRAAPRSSSLSLGRRRRRTR
RRRRRRRQGLGRGSEPEPEEEDPARRSGGGGGVPPPGPARPRPRRGPGGGCLDVEFVMSP
AGCSHVNSFKVENWRQNLRVIYQCFVWSGTPETRKRKAKSCICHMCGAHLNRLHSCLYCV
FFGCFTKKHIHEHAKTKRHNLAIDLLYGGIYCFMCQDYIYDKDMEQIAKEEQRKAWKLQA
FTPTVVSHYQCTMTGIGEKYSTWEPTKRELELLRHNPKRRKITTNCTIGLRGLINLGNTC
FMNCIVQALTHTPLLRDFFLSDRHKCEMQSPSSCLVCEMSTLFQEFYSGHRSPHIPYRLL
HLVWTHARHLAGYEQQDAHEFLIAALDVLHRHCKGDDNGKKANNPNHCNCIIDQIFTGGL
QSDVTCQVCHGVSTTIDPFWDISLDLPGSSTPFWPLSPGSDGSVVNGESHVSGTTTLTDC
LRRFTRPEHLGSSAKIKCSGCHSYQESTKQLTMKKLPIVACFHLKRFEHSAKLRRKITTY
VSFPLELDMTPFMASSKESRMNGQYQQPTDSLNNDNKYSLFAVVNHQGTLESGHYTSFIR
QHKDQWFKCDDAIITKASIKDVLDSEGYLLFYHKQFLEYE
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
atgccactcttgaagagctctgaaaataagtcagtccgagacatctattcctcctctcta
aacccgaagtggcgtaacgccattaacttccgcttcgaaggggacggcacgtgtaggcgc
tcgcccaattccagcgaaaagaacgtgtactgcgtgtgcaccggcgtgcgtgcgcgcgcg
cgaacaaaggacgtcctcccgccccgagtcccggcgcccaaatcccttaggcagcgctcc
caggtgacctggtgtctccgcccatctgtgacgtttccccccccacccccccgccaaagt
gcgagggaaacatacatctacgtcattttagttccgctcttaattggtgccggtggggat
ccggggaaggatcccgggaagttccgtcctggggtgaagaacagatgtatcccagaaaat
ctgggctgccgggagaatggcccaataaattcagctccacgttctcaaacatgtgttttt
aagacaggtcgcagggcaaaaattcagaatgaaatggcaggacattgccagcacgcattc
atgcatttagttttgcttcccacctggtcttcatccagggaacctaaaggactggggtgc
tacgggacaggaaatcactggggtaacagagagaagctgaagggagaagcggatatgaca
gcagcgctgctcctacaacccagcctgcagcgggcgggctcggctaccagatggaaagtc
accgtcagccaatccccaaccctcacacgcctcccgtgcctcggccgccgcgctttgttc
cgagtcgctttcgcctcaggccgggagggagcgggggaccctcccccgggtctatgtgcc
ccccgcgccgccccgcgcagcagcagcctgagcctcgggaggaggcgccgccggaccagg
aggcggcggcgacggaggaggcagggtctgggccgcggatctgagccggagcctgaggag
gaggacccggcgcggaggagcggcggcggcggcggcgtcccaccccccggccccgcccgg
ccccggccccggcgcggccccggcggcgggtgcctggatgtggagtttgtcatgagtccg
gccggctgctcgcatgtgaacagctttaaggtggagaactggcggcagaacctgcgggtc
atctaccagtgcttcgtgtggagcgggacccctgagaccaggaagcgcaaggcaaagtcg
tgcatctgtcatatgtgtggcgcccacttaaatagactccactcttgcctctactgtgtc
ttctttggctgttttacaaagaaacatattcacgagcacgcaaagacaaagcgacacaac
ttggccatagaccttttgtatgggggtatatactgctttatgtgtcaggattacatatac
gacaaagacatggaacaaattgccaaagaagaacaacggaaagcttggaaattacaagcc
ttcaccccaacagtggtttctcactaccagtgtacaatgacaggaattggagagaagtat
tcaacttgggagccaaccaaacgagaactagaattgcttcgacataatcctaagcggaga
aaaataaccacaaattgtaccataggtctacgagggctaatcaatcttgggaacacgtgt
tttatgaactgtattgtccaagcacttacccacactccactactgcgagatttcttcctc
tctgacaggcacaaatgtgaaatgcaaagtcccagctcatgtctggtttgtgaaatgtct
acgctttttcaggagttttactctgggcaccgatctcctcacattccatataggttactg
cacctggtatggacgcatgcacgacatttagcagggtacgagcaacaggatgcacacgag
ttcctcattgctgcattagatgtgctgcacagacactgcaaaggtgacgataatgggaaa
aaggccaacaaccctaaccactgtaattgtatcatcgaccaaatcttcacaggtggactg
cagtcggatgtcacctgtcaagtttgccatggcgtttctacaacgatagacccattctgg
gacatcagtttagacttgcctggttcttcaactccattctggccacttagtccagggagt
gatggcagcgtggtaaatggggaaagccatgtatccggaaccaccacactcacagactgc
ttgcgaaggtttacaaggccagagcacttaggaagcagtgccaaaatcaaatgtagtggt
tgccatagctaccaggaatccaccaaacaactcactatgaagaaattacccattgtggcc
tgttttcatctcaaacggtttgaacactcagccaaactgaggcgaaagatcactacgtat
gtctccttccccttggagctggacatgacaccatttatggcctccagtaaagagagcaga
atgaatggacagtaccagcagccaacggatagtctaaacaatgataataagtattccttg
tttgcagtagttaatcaccaaggaaccttggagagtgggcactataccagcttcattcga
caacacaaggaccagtggttcaaatgtgatgatgccatcatcactaaggctagcattaag
gatgttctagacagtgaagggtacttactgttctatcacaaacaattcctggagtatgag
tag

DBGET integrated database retrieval system