KEGG   Monodelphis domestica (opossum): 100017243Help
Entry
100017243         CDS       T01031                                 

Gene name
TANK, TRAF2
Definition
TRAF family member-associated NFKB activator
Orthology
K03173  
TNF receptor-associated factor 2
Organism
mdo  Monodelphis domestica (opossum)
Pathway
MAPK signaling pathway
NF-kappa B signaling pathway
Protein processing in endoplasmic reticulum
Apoptosis
Osteoclast differentiation
RIG-I-like receptor signaling pathway
TNF signaling pathway
Adipocytokine signaling pathway
Non-alcoholic fatty liver disease (NAFLD)
Hepatitis C
Herpes simplex infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
Small cell lung cancer
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:mdo04141]
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:mdo04010]
Environmental Information Processing; Signal transduction; NF-kappa B signaling pathway [PATH:mdo04064]
Environmental Information Processing; Signal transduction; TNF signaling pathway [PATH:mdo04668]
Cellular Processes; Cell growth and death; Apoptosis [PATH:mdo04210]
Organismal Systems; Immune system; RIG-I-like receptor signaling pathway [PATH:mdo04622]
Organismal Systems; Endocrine system; Adipocytokine signaling pathway [PATH:mdo04920]
Organismal Systems; Development; Osteoclast differentiation [PATH:mdo04380]
Human Diseases; Cancers; Pathways in cancer [PATH:mdo05200]
Human Diseases; Cancers; Viral carcinogenesis [PATH:mdo05203]
Human Diseases; Cancers; Small cell lung cancer [PATH:mdo05222]
Human Diseases; Endocrine and metabolic diseases; Non-alcoholic fatty liver disease (NAFLD) [PATH:mdo04932]
Human Diseases; Infectious diseases; Hepatitis C [PATH:mdo05160]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:mdo05168]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:mdo05169]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 508 aa AA seqDB search
MATANSTPPGSLDLLQPGFSKDILGTKLEDKYLCSACKNILRRPFQAQCGHRYCSYCLTS
IISTGPQNCAACIQEGIYEEGISILESSSAFPDNAARREVESLPAVCVNDGCTWKGTIKE
YESCHEGHCSFMLIECPACKWMIKLGEKEHHSERECPKRSLNCRYCKALFYYPDIKAHDE
ICPKFPLTCEGCGKKKILREKFQDHVKACGKCKGPCKFHVVGCTEMVENEKQQDHENQKV
AEHLCMLLNFVLEARHFHGDIGPLLGQEMSKSTELLERCETLERKTVTFENIVCVLNREV
ERVSMTAEACSRQHRLDQEKIETLSSKVQQLERSIGLKDLAMADMEQKILEMEASTYDGI
FIWKITDFARKRQEAMAGRSPAIFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVV
MKGPNDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTSSSFQRPVSDMNIASGCPLFC
PVSKMESKNSYVRDDAIFIKAIVDLTGL
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atggcaacagcaaactctactcctccaggctctttagatttgcttcagcctggattttca
aaggatatcttaggaacaaaattagaagataaatatctttgttctgcatgcaagaacatt
ttgagaagaccatttcaagctcagtgtggacatcggtactgctcttattgtctgaccagc
atcataagcactgggcctcagaattgtgctgcctgcattcaggagggaatatatgaagaa
ggcatttctattttagaaagcagttcggcttttccagataatgctgcccgaagagaggta
gaaagcctaccagctgtctgtgtcaatgatggttgtacatggaaaggcactataaaagaa
tatgagagctgccatgaaggacactgctcattcatgctaatcgagtgcccagcatgtaag
tggatgatcaaactgggtgagaaggagcatcattctgagcgggaatgcccaaagagaagc
ctcaactgcagatactgcaaagctcttttctactatcctgatattaaggcccatgatgag
atctgtcccaagtttcccttgacttgtgaaggctgtggtaagaagaaaattcttcgagag
aaatttcaggaccatgtcaaggcctgtggcaaatgcaaaggcccttgcaaattccatgtt
gttggctgtactgaaatggtggaaaatgagaagcagcaagatcatgaaaatcagaaagta
gctgagcacctctgcatgttgttaaactttgtccttgaggccaggcatttccatggagac
attggtcccctccttggccaagagatgtccaagtctacagagctgttggagagatgtgaa
accttggaaagaaaaacagtcacttttgagaacattgtctgtgtcttgaaccgagaagta
gagagagtgtccatgacagctgaggcttgcagcaggcagcaccgcctggaccaggagaaa
attgaaactctcagtagcaaggtccagcagctggaaaggagtataggattaaaagacctg
gcaatggctgacatggaacagaagatccttgagatggaagcttccacttatgatggaatt
ttcatatggaagataacagactttgctagaaaacgacaagaagctatggctggccgctct
cctgccatcttctctccagccttctacacgagcaaatatggctataagatgtgtttgaga
atttatctgaatggggatggcactggacgtgggacccacctttctcttttctttgtcgtg
atgaaaggaccaaatgatgcacttctacgttggccctttaatcaaaaggtgacattaatg
ctgctagatcagaacaaccgggaacatgtgattgatgccttcaggcctgatgtgacatct
tcctctttccaaaggccagtcagtgatatgaacattgccagtggctgtccccttttctgt
cctgtctctaaaatggagtcaaagaattcttatgtgcgcgatgacgccattttcatcaaa
gccatcgttgatttgacgggtctctaa

DBGET integrated database retrieval system