KEGG   Monodelphis domestica (opossum): 100017331Help
Entry
100017331         CDS       T01031                                 

Gene name
USP9X
Definition
ubiquitin specific peptidase 9, X-linked
Orthology
K11840  
ubiquitin carboxyl-terminal hydrolase 9/24 [EC:3.1.2.15]
Organism
mdo  Monodelphis domestica (opossum)
Brite
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100017331 (USP9X)
Peptidases [BR:mdo01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100017331 (USP9X)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
4
AA seq 2553 aa AA seqDB search
MTATTRGSPVGGNDSQGQAPDGQSQPPLQQNQTSSPDSSNENSPATPPDEQGQGDAPPQL
EDEEPAFPHTDLAKLDDMINRPRWVVPVLPKGELEVLLEAAIDLSKKGLDVKSEACQRFF
RDGLTISFTKILTDEAVSGWKFEIHRCIINNTHRLVELCVAKLSQDWFPLLELLAMALNP
HCKFHIYNGTRPSETIPAGVQLAEDELYARPPDPRSPKGWLVDLINKFGTLNGFQILHDR
FISGSALNVQIIAALIKPFGQCYEFLTLHTVKKYFLPIIEMVPQFLENLTDDELKKEAKN
EAKNDALSMIIKSLKNLASRVPGQEETVKNLEIFRLKMILRLLQISSFNGKMNALNEVNK
VISSVSYYTHRHGNPEEEEWLTAERMAEWIQQNNILSIVLRDSLHQPQYVEKLEKILRFV
IKEKALTLQDLDNIWAAQAGKHEAIVKNVHDLLAKLAWDFSPEQLDHLFDCFKASWTNAS
KKQREKLLELIRRLAEDDKDGVMAHKVLNLLWNLAHSDDVPVDIMDQALSAHIKILDYSC
SQDRDTQKIQWIDRFIEELRTNDKWVIPALKQIREICSLFGEAPQNLSQTQRSPHVFYRH
DLINQLQHNHALVTLVAENLSAYMESMRQYAKEHGEYDPQTVRPGSRYSHVQEVQERLNF
LRFLLKDGQLWLCAPQAKQIWKCLAENAVYLCDREACFKWYSKLMGDEPDLDPDINKDFF
ENNVLQLDPSLLTENGMKCFERFFKAVNCREGKLVAKRRAYMMDDLELIGLDYLWRVVIQ
GSDDIASRAIDLLKEIYTNLGPRLQVNQVVIHEDFIQSCFDRLKASYDTLCVLDGDKDSI
NCARQEAIRMVRVLTVLREYINECDSDYHEERTILPMSRAFRGKHITLVVRFPNQGRQVE
DLDIWSHTNDTIGSVRRCILNRIKANSAHTKIELFIGGELVDPADDRKLIGQLNLKDKTL
ITAKLTQISSNMPSSPDSSSDSSTGSPGNHGNHYSDGPNPEVESCLPGVIMSMHPRYISF
LWQVADLGSSLNMPPLRDGARVLMKLMPPDNTTIEKLRAICLDHAKLGESSLSPSLDSLF
FGPSASQVLYLTEVVYALLMPANAPLGEDASDFQYNFLKSGGLPLVLSMLTRNNFLPNAD
METRRGAYLNALKIAKLLLTAVGYGHVRAVAEACQPVAEGTNPMSPINQATHDQAVVLQN
ALQNIPNPTSECMLRNVAIRLAQQISDEASKYIPDICVIRAVQKIVWASGSGSVQLVFSS
NDDISKIYEKTNAGNEPDMEDEHVCCEALEVMTLCFALIPTALDALSKEKAWQTFIIDLL
LHCHSKTVRQMAQEQFFLMSTRCCMGHRPLLFFITLLFTVLGSTAREKAKHSGDYFTLLR
HLLNYAYNSNINVPNAEVLLNNEIDWLKRIRDEVKRTGETGVEETILEGHLGVTKELLAF
QTPEKKYHIGCEKGGANLIKELIDDFIFPASNVYLQYMRNGELPAEQAIPVCSSPATINA
GFELLVALAVGCVRNLKQIVDTLTEMYYIGTAITTCEALTEWEYLPPVGPRPPKGFVGLK
NAGATCYMNSVIQQLYMIPAIRNGILAIEGTGSDVDDDMSGDEKQDNESNVDPRDDVFGY
PHQYEDKPALNKTEDRKEYNIGVLRHLQVIFGHLAASRLQYYVPRGFWKQFRLWGEPVNL
REQHDALEFFNSLVDSLDEALKALGHPAMLSKVLGGSFADQKICQGCPHRYECEESFTTL
NVDIRNHQNLLDSLEQYVKGDLLEGANAYHCEKCNKKVDTVKRLLIKKLPPVLAIQLKRF
DYDWERECAIKFNDYFEFPRELDMEPYTVAGVAKLEGDDVNPENQLIQQNEQSENEPTGS
TKYRLVGVLVHSGQASGGHYYSYIIQRNGGDGEKNRWYKFDDGDVTECKMDDDEEMKNQC
FGGEYMGEVFDHMMKRMSYRRQKRWWNAYILFYERMDTIDKDNELIKYISELVVTTKPHQ
IKMPSAIERSVRKQNVQFMHNRMQYSLEYFQFVKKLLTCNSVYLNPPPGQDHLLPEAEEI
TMISIQLAARFLFTTGFHTKKIVRGPASDWYDALCILLRHSKNVRFWFAHNVLFNVSNRF
SEYLLECPSAEVRGAFAKLIVFIAHFSLQDGPCPSPFASPGPSSQAYDNLSLSDHLLRAV
LNLLRREVSEHGRHLQQYFNLFVMYANLGMAEKTQLLKLSVPATFMLVALDEGPGPPIKY
QYAELGKLYTVVSQLIRCCNVSSRMQSSINGNPPLSNPYGDPNLSQPIMALQQNVADILF
VRTSYVKKIIEDCSNSEETIKLLRFCCWENPQFSSTVLSELLWQVAYSYTYELRPYLDLL
LQILLIEDSWQTHRIHNALKGIPDDRDGLFDTIQRSKNHYQKRAYQCIKCMVALFSNCPV
AYQILQSNGDLKRKWTWAVEWLGDELERRPYTGNPQYTYNNWSPPVQSNETSNGYFLERS
HSARMTLAKACELCPEEEPDDQDAPDEHESSPPEDAPLYPHSPGSQYQQNNHVHGQPYTG
PAAHHMNNPQRTGQRAQENYEGNEEVSPPQTKD
NT seq 7662 nt NT seq  +upstreamnt  +downstreamnt
atgacagccacgactcgtggctctccagtaggagggaatgacagccagggccaggctcct
gatggacagtcccagccccccctccaacagaatcagacttcatcgcctgattcttctaat
gagaactccccagcaacaccccctgatgaacagggccaaggtgatgccccaccccagctt
gaagatgaggaacctgcatttccccacactgacctggcaaagttggacgacatgatcaac
agaccccgatgggtggttccagttttgccaaagggggaattagaagttcttttagaagct
gctattgatcttagtaaaaaaggtcttgatgttaaaagtgaagcatgtcaacgttttttt
cgagatgggctaacaatatctttcactaaaatccttacggatgaggcagtgagtggctgg
aagtttgaaattcataggtgtattattaacaacactcatcgcctagtggagctttgtgtg
gccaagctttctcaagactggtttccacttctagaacttcttgctatggccttaaatcct
cattgcaaattccatatatataatggtacacgcccatctgaaacaattcctgctggtgtt
cagttggcagaagatgaactctacgcccgtcctccagacccacgatctccaaaaggttgg
ttagtggatctcatcaataaatttggcacattaaacgggttccagattttgcacgatcgc
ttcattagtggctcggcattgaatgtccaaattattgcagctcttattaaaccatttgga
caatgctatgagtttctgacacttcatacagtgaagaaatacttccttccaattatagaa
atggttccacagtttttagaaaacttaactgatgatgaactgaaaaaagaagcaaaaaat
gaagcaaaaaatgatgctttgtctatgataataaaatctttgaagaatttagcttcaagg
gtaccaggacaagaagaaactgtaaaaaatttagaaatatttaggttaaaaatgatactt
aggttgttacaaatttcttctttcaatggcaagatgaatgccctaaatgaggttaataag
gtgatctctagtgtgtcatattatacccatcgtcatggtaatcctgaggaagaagagtgg
ctcactgcagaacgaatggcagaatggatacagcagaacaatattttatccatagtttta
cgggatagtcttcatcaaccacagtatgtagaaaaattggagaagattcttcgttttgtt
ataaaagaaaaagctctcactttgcaagatcttgataatatttgggcagcacaggcagga
aaacatgaagccattgtaaagaatgtacatgatctcctggcaaaattggcttgggatttt
tctcctgaacaacttgatcatctctttgactgctttaaggcaagttggacaaatgcaagc
aaaaaacagcgtgaaaaattacttgagctaatacgtcgtcttgcagaagatgataaagat
ggtgtgatggcccataaagtgttgaacctgttgtggaatttggcccatagtgatgatgtg
ccggttgatatcatggaccaggctcttagtgctcacattaaaatcttagattatagttgt
tcacaggatcgagacacccaaaagatccaatggatagatcgttttatagaagaacttcgc
acaaatgataagtgggtaattcctgcactgaaacaaattagggaaatttgtagtttgttt
ggtgaagcaccacaaaatttgagtcaaacacagcgaagcccacatgtgttttatcgtcat
gatttaatcaatcaacttcagcacaatcatgccctagttactctggtagcagaaaatctc
tctgcttatatggaaagcatgagacagtatgcaaaagagcatggagaatatgatccacaa
actgtaagaccaggaagtagatatagtcatgtgcaagaagtccaagagcgacttaatttc
ctaagatttttgttgaaggatggtcaactatggctatgtgctcctcaggcaaagcaaatt
tggaaatgtttagctgaaaatgcagtttatctttgtgatcgtgaagcctgttttaagtgg
tattccaagttgatgggagatgaaccagaccttgatcctgacattaataaggattttttt
gaaaataatgtgcttcagctcgatccttccctattaacagaaaatggaatgaaatgtttt
gagcgtttcttcaaagctgtgaactgtcgagaagggaaactagtagcaaaacggcgagcc
tatatgatggatgatttagaattgatcggtttagattatctttggagggttgtgattcag
ggaagcgatgacattgccagcagagcaattgaccttcttaaggagatctatactaatctt
ggaccaaggttacaagttaatcaggtagtgatccatgaagacttcattcaatcctgcttt
gatcgcttgaaagcctcctatgatacattatgtgtcctggatggtgacaaagacagtatt
aattgtgcacgacaggaagcaatacgaatggtgcgagttttgactgttttaagggaatat
ataaatgaatgtgacagtgattatcatgaagaaaggacaattctacctatgtcaagagct
tttcgtggtaaacacatcactttggtagttcgttttccaaatcaaggtcggcaggtagaa
gacttggacatctggtctcatacaaatgacacaattggttcagtgagacgatgcattctc
aatcgtattaaagctaatagtgcccatacaaaaatagagctatttattggtggtgaactg
gtggatcctgcagatgataggaaactaattggacaattaaatctaaaagataaaacgcta
attacagccaaacttacacaaataagttccaatatgccttcaagtcctgatagttcttct
gattcatcaactggttctcctggtaaccatggaaatcattatagtgatggtcccaatcca
gaggtagaaagctgtttgcctggagtgataatgtcaatgcatcccagatatatttctttc
ctttggcaagttgcagacttgggtagcagcctaaatatgccacccctcagagatggagct
cgagtacttatgaaacttatgccaccagataataccacaattgaaaaactgagagctatt
tgcttagaccatgcaaaacttggagaaagcagcctcagtccatctcttgactcacttttc
tttggtccctctgcctcacaagtgctatatctaacagaggtagtttatgccttgttgatg
cctgccaatgcacctctgggtgaagatgccagtgattttcagtataatttcttaaaaagt
ggtggcttacctcttgtcctgagcatgctaactagaaataatttcctgccaaatgcagat
atggaaactcgacggggcgcctaccttaatgctcttaaaatcgccaaattattgttaact
gccgttggctatggccacgttcgagctgtggcagaagcttgtcaaccagttgcagaaggc
acaaatcccatgtcaccgataaatcaagctactcatgatcaagcagtggtgctacagaat
gcccttcaaaacattcctaatccaacatctgaatgtatgcttagaaatgtggcaattcgt
cttgcccagcagatatccgatgaggcatcaaaatacatccctgatatctgtgtaattcga
gctgtacaaaaaattgtctgggcctcagggtctgggtcagtacaactggtgtttagctca
aatgacgatattagtaaaatttatgagaagactaatgcaggaaatgaaccagatatggaa
gatgaacacgtttgttgtgaagcattggaagtgatgacactgtgctttgctttgattcca
acagccttagatgcacttagtaaagaaaaagcatggcagacatttatcattgacttgctc
ttgcactgtcatagcaaaactgttcgtcagatggcacaggaacagttttttttaatgtct
accagatgttgcatgggacacagacctctacttttcttcattactttattatttactgtt
ttagggagcacagcaagagagaaagctaaacattcaggagattattttactctattaagg
catcttctaaattatgcttacaatagtaacattaatgtgcccaatgctgaagttcttcta
aataatgaaattgattggcttaaaaggatcagggatgaagttaaaagaacaggtgaaaca
ggtgtggaagagacaatcttggaaggtcaccttggagtaacaaaagagttactggccttt
caaactcctgaaaagaaataccatattggttgtgaaaaggggggtgctaatcttattaaa
gagttgattgatgacttcatctttcctgcatctaatgtttacttacaatacatgagaaat
ggagaactgccagctgagcaggccataccagtctgtagttcaccagctaccatcaatgct
ggttttgagctgcttgtagcattagctgttggttgtgtgagaaatctcaaacagatagtg
gacacattgacagagatgtattacataggtacagcaataactacttgtgaggcacttacg
gaatgggaatatctgccaccggttggacctcgaccaccaaaaggatttgtggggctgaaa
aatgctggtgctacttgttatatgaattcagtgatccagcaactgtacatgattcctgcc
atcaggaatggtattcttgcaatagaaggcactggcagtgatgtagatgatgatatgtct
ggagatgagaagcaagacaatgagagtaatgttgatcctcgagatgatgtatttgggtat
cctcatcaatatgaagacaaaccagcattgaataaaactgaagacagaaaggaatacaat
attggagttttaagacatcttcaggtcatttttggtcatttagcagcttctagattacaa
tactacgtaccaagaggattttggaagcaatttaggctttggggtgaacctgttaaccta
cgtgaacaacatgatgctttagaatttttcaattctttggtggatagtttagacgaagct
ttaaaagcattgggacatcctgctatgctaagtaaagtcttaggaggttcttttgctgat
cagaagatttgccaaggttgtccacataggtacgaatgtgaagaatcatttacgactctg
aatgtagatattagaaatcaccaaaaccttcttgattctttggaacaatatgtcaaggga
gacttactggaaggcgcaaatgcatatcattgtgaaaaatgcaacaaaaaggttgataca
gtaaaacgcctcctaattaagaaattgcccccggttcttgccattcagctaaaacgattc
gactatgactgggaaagggaatgtgcaatcaagttcaatgattactttgaatttccacgg
gaattggacatggaaccttatacagtggcaggtgttgcaaagctggaaggggatgatgta
aaccctgaaaatcagttgatacaacaaaatgaacagtcagaaaatgagccaactggaagc
acaaagtatagactggtgggtgtacttgtacacagtggtcaagcaagtggaggacattat
tattcctatatcatccagaggaatggtggagatggtgagaaaaatcgctggtataaattt
gatgatggagatgtaacagaatgtaaaatggatgatgatgaagaaatgaaaaaccagtgt
tttggtggagagtacatgggtgaagtatttgatcatatgatgaagcgcatgtcatatagg
cgccagaagaggtggtggaatgcttacattcttttttatgaacgaatggacacaatagac
aaagacaatgaattaatcaaatatatttcagagttggttgtcaccacaaaaccccaccag
attaaaatgccatcagccattgaaagaagtgtacggaaacagaatgtgcaattcatgcat
aatcgtatgcaatacagtttggaatatttccagttcgtaaaaaagctgctgacttgtaac
agtgtatacttaaacccccctccagggcaagatcatctgttgcctgaagcagaagaaatt
acaatgattagtattcagcttgctgctagattccttttcaccacaggatttcacacaaaa
aaaatagtccgtggccctgccagtgattggtatgatgcattgtgtattctactccgtcac
agcaagaatgtacgcttttggtttgcacataatgtcctctttaatgtttcaaatcgcttt
tctgagtaccttctggaatgccccagtgcagaagtgaggggcgcatttgcaaaacttata
gtatttattgcacatttttcattgcaagatgggccatgtccttcaccttttgcttctcct
ggaccttctagtcaggcatatgataatttaagcttgagtgatcatttgctgagagcagta
ctaaatctcctcagaagggaagtttcagagcatgggcgtcatttgcagcagtatttcaat
ctgtttgtgatgtatgccaacctaggtatggcagaaaaaacacagcttttgaaactgagt
gtgcctgccacatttatgcttgtagctctggatgaagggccaggtccacccatcaaatat
cagtatgccgagctaggcaaattatatactgtagtgtcacaattgatccgttgttgcaat
gtatcatcccggatgcagtcttcaatcaatggtaatccccctctttcgaacccttatggt
gatcctaatttatctcaacctataatggcacttcagcagaatgtggcagatattttgttt
gtgagaacaagttatgtgaagaaaattattgaagactgcagtaactcagaggaaaccatc
aaattgcttcgtttttgctgttgggagaatcctcagttctcttctacagtcctcagtgaa
ctactttggcaggttgcctattcatatacctatgaactccgaccttatttggatctcctt
ttacaaatcttattaattgaggactcctggcagacacacagaattcataatgcacttaaa
ggaatcccagatgatcgagatggactatttgatacaattcaacgctctaaaaatcattat
cagaaaagagcttatcagtgtataaaatgtatggtagctctctttagtaactgtcctgta
gcctaccaaatcctgcagagtaatggagatctaaaaagaaagtggacctgggcagtggag
tggcttggggatgagcttgaacgacgaccatatactggcaatcctcaatatacatacaac
aactggtctcctccagtacaaagcaacgaaacatcaaatggttactttttggagagatca
catagtgcccggatgacccttgcaaaagcttgtgaactctgtccagaggaggaaccagat
gaccaagatgccccagatgaacatgaatcatctccaccagaagatgccccattatatccc
cactcacctggatctcagtatcagcagaataaccatgtgcatggacagccatatacaggc
ccagcagcacatcacatgaacaaccctcagagaactggccaacgagcacaagaaaattat
gaaggcaatgaagaagtttccccacctcagacaaaagattag

DBGET integrated database retrieval system