KEGG   Monodelphis domestica (opossum): 100017332Help
Entry
100017332         CDS       T01031                                 

Gene name
PIK3CB
Definition
(RefSeq) phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit beta
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00562  Inositol phosphate metabolism
mdo01521  EGFR tyrosine kinase inhibitor resistance
mdo01522  Endocrine resistance
mdo01524  Platinum drug resistance
mdo04012  ErbB signaling pathway
mdo04014  Ras signaling pathway
mdo04015  Rap1 signaling pathway
mdo04024  cAMP signaling pathway
mdo04062  Chemokine signaling pathway
mdo04066  HIF-1 signaling pathway
mdo04068  FoxO signaling pathway
mdo04070  Phosphatidylinositol signaling system
mdo04071  Sphingolipid signaling pathway
mdo04072  Phospholipase D signaling pathway
mdo04140  Autophagy - animal
mdo04150  mTOR signaling pathway
mdo04151  PI3K-Akt signaling pathway
mdo04152  AMPK signaling pathway
mdo04210  Apoptosis
mdo04211  Longevity regulating pathway
mdo04213  Longevity regulating pathway - multiple species
mdo04218  Cellular senescence
mdo04360  Axon guidance
mdo04370  VEGF signaling pathway
mdo04380  Osteoclast differentiation
mdo04510  Focal adhesion
mdo04550  Signaling pathways regulating pluripotency of stem cells
mdo04611  Platelet activation
mdo04620  Toll-like receptor signaling pathway
mdo04625  C-type lectin receptor signaling pathway
mdo04630  Jak-STAT signaling pathway
mdo04650  Natural killer cell mediated cytotoxicity
mdo04660  T cell receptor signaling pathway
mdo04662  B cell receptor signaling pathway
mdo04664  Fc epsilon RI signaling pathway
mdo04666  Fc gamma R-mediated phagocytosis
mdo04668  TNF signaling pathway
mdo04670  Leukocyte transendothelial migration
mdo04722  Neurotrophin signaling pathway
mdo04725  Cholinergic synapse
mdo04750  Inflammatory mediator regulation of TRP channels
mdo04810  Regulation of actin cytoskeleton
mdo04910  Insulin signaling pathway
mdo04914  Progesterone-mediated oocyte maturation
mdo04915  Estrogen signaling pathway
mdo04917  Prolactin signaling pathway
mdo04919  Thyroid hormone signaling pathway
mdo04923  Regulation of lipolysis in adipocytes
mdo04926  Relaxin signaling pathway
mdo04930  Type II diabetes mellitus
mdo04931  Insulin resistance
mdo04932  Non-alcoholic fatty liver disease (NAFLD)
mdo04933  AGE-RAGE signaling pathway in diabetic complications
mdo04960  Aldosterone-regulated sodium reabsorption
mdo04973  Carbohydrate digestion and absorption
mdo05100  Bacterial invasion of epithelial cells
mdo05142  Chagas disease (American trypanosomiasis)
mdo05146  Amoebiasis
mdo05160  Hepatitis C
mdo05161  Hepatitis B
mdo05162  Measles
mdo05164  Influenza A
mdo05165  Human papillomavirus infection
mdo05166  HTLV-I infection
mdo05167  Kaposi's sarcoma-associated herpesvirus infection
mdo05169  Epstein-Barr virus infection
mdo05200  Pathways in cancer
mdo05203  Viral carcinogenesis
mdo05205  Proteoglycans in cancer
mdo05210  Colorectal cancer
mdo05211  Renal cell carcinoma
mdo05212  Pancreatic cancer
mdo05213  Endometrial cancer
mdo05214  Glioma
mdo05215  Prostate cancer
mdo05218  Melanoma
mdo05220  Chronic myeloid leukemia
mdo05221  Acute myeloid leukemia
mdo05222  Small cell lung cancer
mdo05223  Non-small cell lung cancer
mdo05224  Breast cancer
mdo05225  Hepatocellular carcinoma
mdo05226  Gastric cancer
mdo05230  Central carbon metabolism in cancer
mdo05231  Choline metabolism in cancer
mdo05418  Fluid shear stress and atherosclerosis
Module
mdo_M00676  PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100017332 (PIK3CB)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    100017332 (PIK3CB)
   04015 Rap1 signaling pathway
    100017332 (PIK3CB)
   04012 ErbB signaling pathway
    100017332 (PIK3CB)
   04370 VEGF signaling pathway
    100017332 (PIK3CB)
   04630 Jak-STAT signaling pathway
    100017332 (PIK3CB)
   04668 TNF signaling pathway
    100017332 (PIK3CB)
   04066 HIF-1 signaling pathway
    100017332 (PIK3CB)
   04068 FoxO signaling pathway
    100017332 (PIK3CB)
   04070 Phosphatidylinositol signaling system
    100017332 (PIK3CB)
   04072 Phospholipase D signaling pathway
    100017332 (PIK3CB)
   04071 Sphingolipid signaling pathway
    100017332 (PIK3CB)
   04024 cAMP signaling pathway
    100017332 (PIK3CB)
   04151 PI3K-Akt signaling pathway
    100017332 (PIK3CB)
   04152 AMPK signaling pathway
    100017332 (PIK3CB)
   04150 mTOR signaling pathway
    100017332 (PIK3CB)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100017332 (PIK3CB)
  Cell growth and death
   04210 Apoptosis
    100017332 (PIK3CB)
   04218 Cellular senescence
    100017332 (PIK3CB)
  Cellular community - eukaryotes
   04510 Focal adhesion
    100017332 (PIK3CB)
   04550 Signaling pathways regulating pluripotency of stem cells
    100017332 (PIK3CB)
  Cell motility
   04810 Regulation of actin cytoskeleton
    100017332 (PIK3CB)
 Organismal Systems
  Immune system
   04611 Platelet activation
    100017332 (PIK3CB)
   04620 Toll-like receptor signaling pathway
    100017332 (PIK3CB)
   04625 C-type lectin receptor signaling pathway
    100017332 (PIK3CB)
   04650 Natural killer cell mediated cytotoxicity
    100017332 (PIK3CB)
   04660 T cell receptor signaling pathway
    100017332 (PIK3CB)
   04662 B cell receptor signaling pathway
    100017332 (PIK3CB)
   04664 Fc epsilon RI signaling pathway
    100017332 (PIK3CB)
   04666 Fc gamma R-mediated phagocytosis
    100017332 (PIK3CB)
   04670 Leukocyte transendothelial migration
    100017332 (PIK3CB)
   04062 Chemokine signaling pathway
    100017332 (PIK3CB)
  Endocrine system
   04910 Insulin signaling pathway
    100017332 (PIK3CB)
   04923 Regulation of lipolysis in adipocyte
    100017332 (PIK3CB)
   04915 Estrogen signaling pathway
    100017332 (PIK3CB)
   04914 Progesterone-mediated oocyte maturation
    100017332 (PIK3CB)
   04917 Prolactin signaling pathway
    100017332 (PIK3CB)
   04926 Relaxin signaling pathway
    100017332 (PIK3CB)
   04919 Thyroid hormone signaling pathway
    100017332 (PIK3CB)
  Digestive system
   04973 Carbohydrate digestion and absorption
    100017332 (PIK3CB)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    100017332 (PIK3CB)
  Nervous system
   04725 Cholinergic synapse
    100017332 (PIK3CB)
   04722 Neurotrophin signaling pathway
    100017332 (PIK3CB)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    100017332 (PIK3CB)
  Development
   04360 Axon guidance
    100017332 (PIK3CB)
   04380 Osteoclast differentiation
    100017332 (PIK3CB)
  Aging
   04211 Longevity regulating pathway - mammal
    100017332 (PIK3CB)
   04213 Longevity regulating pathway - multiple species
    100017332 (PIK3CB)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    100017332 (PIK3CB)
   05230 Central carbon metabolism in cancer
    100017332 (PIK3CB)
   05231 Choline metabolism in cancer
    100017332 (PIK3CB)
   05205 Proteoglycans in cancer
    100017332 (PIK3CB)
   05203 Viral carcinogenesis
    100017332 (PIK3CB)
   05210 Colorectal cancer
    100017332 (PIK3CB)
   05212 Pancreatic cancer
    100017332 (PIK3CB)
   05225 Hepatocellular carcinoma
    100017332 (PIK3CB)
   05226 Gastric cancer
    100017332 (PIK3CB)
   05214 Glioma
    100017332 (PIK3CB)
   05221 Acute myeloid leukemia
    100017332 (PIK3CB)
   05220 Chronic myeloid leukemia
    100017332 (PIK3CB)
   05218 Melanoma
    100017332 (PIK3CB)
   05211 Renal cell carcinoma
    100017332 (PIK3CB)
   05215 Prostate cancer
    100017332 (PIK3CB)
   05213 Endometrial cancer
    100017332 (PIK3CB)
   05224 Breast cancer
    100017332 (PIK3CB)
   05222 Small cell lung cancer
    100017332 (PIK3CB)
   05223 Non-small cell lung cancer
    100017332 (PIK3CB)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100017332 (PIK3CB)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    100017332 (PIK3CB)
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100017332 (PIK3CB)
   04931 Insulin resistance
    100017332 (PIK3CB)
   04933 AGE-RAGE signaling pathway in diabetic complications
    100017332 (PIK3CB)
  Infectious diseases
   05100 Bacterial invasion of epithelial cells
    100017332 (PIK3CB)
   05166 HTLV-I infection
    100017332 (PIK3CB)
   05162 Measles
    100017332 (PIK3CB)
   05164 Influenza A
    100017332 (PIK3CB)
   05161 Hepatitis B
    100017332 (PIK3CB)
   05160 Hepatitis C
    100017332 (PIK3CB)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    100017332 (PIK3CB)
   05169 Epstein-Barr virus infection
    100017332 (PIK3CB)
   05165 Human papillomavirus infection
    100017332 (PIK3CB)
   05146 Amoebiasis
    100017332 (PIK3CB)
   05142 Chagas disease (American trypanosomiasis)
    100017332 (PIK3CB)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    100017332 (PIK3CB)
   01524 Platinum drug resistance
    100017332 (PIK3CB)
   01522 Endocrine resistance
    100017332 (PIK3CB)
Enzymes [BR:mdo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100017332 (PIK3CB)
Membrane trafficking [BR:mdo04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    100017332 (PIK3CB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_p85B PI3K_C2 Tom37_C RWD DUF4381 DUF4135
Motif
Other DBs
NCBI-GeneID: 100017332
NCBI-ProteinID: XP_016289042
Ensembl: ENSMODG00000018581
Position
4
AA seq 1069 aa AA seqDB search
MCFSFIMPPAMADILDIWAVDSQIASDGSIPVDFLLPTGIYIQLEVPREATISHIKQMLW
KQAHSYPMFNLLMEIDSYMFACVNQTAVYEELEDETRRLCDVRPFLPVLKVVTRNCDPGE
KLDSKIGVLIGKGLHEFDALEDPEVMEFRSKMRQFSEEKIQSLIGLSWMDWLKHTYPPEQ
EPSIPENLEDKLYGGNLVVAVHFENCQDVFSFQVSPNMNPIKLNELAIRKRLTIHGKEDE
VDPYDYVLQVSGRLEYVFGDHPLIQFQYIRNCVMNRTLPKLTLVECCNIKKMCEQEMIAI
EAAINRNSSNLPLPLPPKKTRIISNVWENTQPFQIVLVKGTKLNTEETVKVHVRAGLFHG
TELLCKPVVSSEISGRNDHVWSEPLEFDINICDLPRMARLCFAVYAVDKVKTKKSTKAIN
PSKYQTIRKAGKVHYPVAWVNTMVFDFKGQLKSGDIILHSWSSFPDELEEMLNPMGTVQT
NPYTENATALHIKFPENKKQPYYYPPFDKIIEKAAEIASSDSGNVSSRGGKKFHVVLKEI
MERDPLSQLCENEMDLIWTLRQDCRENFPQSLPKLLLSVKWNKLEDVAQLQALLQXWPKL
PPREALELLDFNYPDQYVREYAVGCLKQMSDEELSQYLLQLVQVLKYEPFLDCALSRFLL
DRALANRRIGQFLFWHLRSEVHIPAFSVQFGVILEAYCRGSVGYMKVLSKQVEALNKLKT
LNSLIKLNAMKLNKAKGREAMHTCLKQNAYREALSDLQSPLNPCVILSELYVEKCKYMDS
KMKPLRIVYNNKVFGGDPVGVIFKNGDDLRQDMLTLQMLRLMDLLWKEAGLDLRMLPYGC
LATGDRSGLIEVVSTSETIADIQLNSSNVAATAAFNKDALLNWLKEYNSGDDLDRAIEEF
TLSCAGYCVASYVLGIGDRHSDNIMVRKTGQLFHIDFGHILGNFKSKFGIKRERVPFILT
YDFIHVIQQGKTGNTEKFGRFRQCCEDAYLILRRHGNLFITLFALMLTAGLPELTSVKDI
QYLKDSLALGKSDEEALKQFKQKFDEALRESWTTKVNWMAHTMRKDYRS
NT seq 3210 nt NT seq  +upstreamnt  +downstreamnt
atgtgcttcagttttataatgcctcctgctatggcagacatccttgacatttgggctgtg
gattctcagatagcatcagatggctccattccagtggatttcctattgcccacggggatc
tatatccaattggaagtacctcgggaggccactatttctcatattaaacagatgctatgg
aagcaagctcacagctacccaatgtttaatcttcttatggaaattgactcttacatgttt
gcatgtgtgaaccaaactgcagtttatgaggagctcgaagatgaaacaagaagactctgt
gatgtcagaccttttcttccagttctcaaagtggtgacaagaaattgtgacccaggggaa
aaattagactccaaaattggagttcttataggaaaaggtcttcatgagtttgatgccctg
gaagatcctgaggtgatggagttccgaagtaaaatgcgccaattcagtgaagaaaagatc
caatcccttataggattgtcttggatggattggttaaagcatacttatccaccagaacaa
gaaccttccattcctgaaaatttggaagataaactttatggtggaaatcttgtggtagct
gtgcattttgaaaattgccaggatgtatttagtttccaagtatctcctaatatgaatccc
atcaagctaaatgagttggcaatccgaaaacggttgactatccatgggaaggaagatgaa
gttgatccctatgactatgtgctacaagtcagtgggagactagaatatgtgtttggtgat
cacccactaattcagttccaatatattcggaactgtgtcatgaataggactcttcccaaa
ctcactcttgttgaatgttgcaatataaagaagatgtgtgaacaggaaatgattgccata
gaagctgccataaatcgaaattcatccaaccttcctcttccactgccaccaaaaaaaaca
cgaataatttctaatgtttgggaaaatacacaaccatttcaaattgtattggttaagggg
actaaattgaacacagaagaaactgtcaaagttcatgtcagggctggactttttcatgga
accgaacttctttgtaaaccagttgtaagctcagagatatctgggagaaatgaccacgtt
tggagtgaaccattggaattcgatattaacatctgtgacttaccacgaatggctcggtta
tgttttgcagtttatgctgtggataaagtgaaaacaaaaaagtcaactaaggcaattaat
ccctccaaatatcagactatcagaaaagctggaaaagtgcactatcctgtagcatgggta
aataccatggtatttgactttaaaggacagctgaaaagtggagacattatactgcacagc
tggtcatcatttcctgatgaacttgaagaaatgttaaatccaatgggaactgttcaaaca
aatccatatactgaaaatgcaacagctttacatattaaattccctgagaataaaaaacaa
ccttattattaccctccctttgataagattattgaaaaggcagctgagattgcaagtagt
gacagtggtaatgtatcaagtcgaggtggaaaaaaatttcatgttgtgcttaaagaaatc
atggagagagatcccttatctcaactgtgtgaaaatgaaatggatcttatttggactttg
cgacaagactgtagagaaaattttccacagtctttgccaaaattgctgctgtctgtcaaa
tggaataaacttgaagatgttgctcagctacaggctcttcttcaantatggcctaaattg
cctcctagagaagcattggaattattagactttaattatccagaccagtatgtaagagag
tatgctgtgggatgcttgaaacaaatgagtgatgaagaactgtctcagtatcttttacaa
ctggtacaagttttgaaatatgaaccttttcttgattgtgcactgtctagattcctgtta
gacagagcacttgctaataggaggatagggcaatttctattttggcatcttaggtcagag
gtgcacattcctgccttttcagtgcaatttggtgtaatacttgaagcttactgtcgggga
agtgtgggctatatgaaagtgctttctaaacaggtagaagctcttaataagctgaagacc
ttaaatagtttaataaaactgaatgcaatgaagttaaacaaagcaaaaggaagagaggca
atgcacacgtgcttaaaacaaaatgcttaccgagaagccctttctgatcttcagtcacct
ttgaatccttgtgtcatactttcagaactttatgttgagaaatgcaaatacatggattct
aagatgaagcctctgagaatcgtgtacaacaataaggtatttggaggagatccagtgggg
gtcattttcaaaaatggggatgatctacgacaagatatgttaacactccagatgttgcgt
ttgatggatttactttggaaagaagcaggtttggatctccgaatgctgccatatggttgt
ttagcaacaggagaccgctctggcctgattgaagttgttagcacctctgaaacaattgcc
gatattcagctaaatagtagtaatgttgctgctacagccgccttcaataaagatgctctt
ctaaactggcttaaagaatacaattccggcgatgacttagatcgcgccattgaagagttc
actctctcctgtgctggctactgtgtagcttcttatgtcttaggaattggtgatagacat
agtgacaatatcatggtcaggaagactggacagctcttccacatcgattttgggcatatt
cttggaaacttcaagtctaaatttggcattaaacgggaacgagtgcctttcattcttacc
tatgatttcattcatgtcattcagcaaggaaaaacaggaaacacagagaagtttggccgg
ttccgtcagtgttgtgaagatgcttatctgattttacgaagacacgggaatctctttatc
actctgtttgccctgatgttgactgcagggcttcctgagctcacctccgtgaaagatata
cagtatcttaaggactctttggccttagggaagagtgatgaagaagcactaaaacaattt
aagcagaaatttgatgaggcactcagggaaagttggactactaaagtaaactggatggcg
cacaccatgagaaaagattaccggtcttaa

DBGET integrated database retrieval system