KEGG   Monodelphis domestica (opossum): 100017402Help
Entry
100017402         CDS       T01031                                 

Gene name
GTF3C4
Definition
(RefSeq) general transcription factor IIIC subunit 4
  KO
K11310  
general transcription factor 3C polypeptide 4 [EC:2.3.1.48]
Organism
mdo  Monodelphis domestica (opossum)
Brite
Enzymes [BR:mdo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100017402 (GTF3C4)
Transcription machinery [BR:mdo03021]
 Eukaryotic type
  RNA polymerase III system
   Basal transcription factors
    TFIIIC
     100017402 (GTF3C4)
Chromosome [BR:mdo03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100017402 (GTF3C4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 932 aa AA seqDB search
MRPEPRHPPPPAPFPFPPPLNTHHPHEGMLVVVRKRPRFLGRQYVSHQCPDLVARQRRGP
SWLGGAPGRGEPGKGGGTGGGGSGSGGGGSLRVPGSGLSTPGKMSVSDEPRVMSSVDEAE
PPEEEEDEEEEEEGKRREKEPVAAAPGAAGAAGPSASFGLVAARREPAVKLQHAVSGLEP
LSWSEDHRVSVSTARSIAVLELICDVHSPGQDLVIHRTSVPAPANSCLLKVGSKKEVVEC
KEKFATSKDPTVSQSFMLDRVFNPEGKSLPPMRGFKYTSWSPMGCDANGRCLLSALTMDN
RLTIQANLNRLQWVQLVDLTEIYGERLYETSYKLTKNEAPEGDLGDFAEFQRRHSMQTPV
RMEWSGICTTQQVKHNNECHDVGSVLLAVLFENGNIAVWQFQLPFIGKESISSCNTIESG
ITSPSVLFWWEYEHNNRKMSGLIVGSAFGPVKILPVNLKAVKGYFTLRQPVILWKEMDQL
PVHSIKCIPLYHPYQKCSCSLVVAARGSYVFWCLLLISKAGLNVHNSHVTGLHTLPIVSM
TADKQNGTVYTCSSDGKVRQLIPIFTDVALKFEHQLIKLSEVFGSVRTHGISVSPCGAYL
AVITTEGMINGLHPVNKNYQVQFVTLKTFEEAAAQLLESSVQNLFKQVDLLDLVRWKILK
DKHIPQFLQEALDKKIESSGSTYFWRFKLFLLRILYQSMQKTPSEVLWKPTHEDNKILIS
DSLGLGHTEEEHQEEGTSFKQIGKPGGHERNKERDAEDLADSSPIQSGDAGREPMEEKLL
EIQGRIEAVEMHLTREHMKRVLGEVYLHTWITENTGIPTRGLCDFLMSDEGYDDRTARVL
IGHISKKMNKQTFPEHCSLCKEILPFTDRKQAVCSNGHIWLRCFLTYQSCQSLIYRRCLL
HDSIARHPTPEDPDWIKRLLQGPCPFCDSPVF
NT seq 2799 nt NT seq  +upstreamnt  +downstreamnt
atgcgcccagagcctcgacaccccccacccccagcccctttccccttccctccacccctc
aatacacatcacccccacgaaggtatgcttgtggtagttcgaaagaggccaaggtttcta
ggcaggcagtacgttagtcaccagtgcccagatttggttgctaggcaacgacggggtcct
tcctggctcggcggcgctccgggccgcggggagccgggaaaaggaggggggaccggaggg
ggcggcagcggcagcggcggcggcgggagtttgcgcgtccccggctcgggcctttccact
ccagggaagatgtctgtgtccgacgagccccgagtgatgtcctcggtggatgaggctgag
ccgccagaggaggaggaagatgaggaggaggaggaggaaggaaaaaggagggagaaggag
ccggtggctgcggcccctggggcagctggggctgcggggcccagcgccagcttcgggctg
gtggcggcgcggcgggagccggccgtgaagctgcagcacgccgtcagcggcctggaaccg
ctctcctggtctgaggaccaccgagtgtcggtttccaccgcccgcagcattgccgtgctg
gagcttatctgcgatgtgcacagcccgggccaggatctggtcatccaccgcacctcagtc
cccgctccggccaacagctgcttgctcaaggttggttcaaaaaaggaagttgttgaatgt
aaggagaaatttgccacctctaaggaccccacagtcagtcaaagcttcatgttagataga
gtgttcaatcctgaaggaaaatctttgcccccaatgagaggattcaagtataccagctgg
tccccaatgggctgtgatgctaatgggagatgcctgttgtcagcattaaccatggacaat
cgcttgaccatccaggctaacctcaacagactacagtgggtacagctggttgatttaact
gagatctatggagagcgtctttatgagaccagctataagctcaccaaaaatgaagcccct
gaaggagacctgggagactttgctgagtttcagaggaggcacagtatgcagacaccagta
cggatggagtggtcaggcatttgcaccacccaacaggtcaagcacaataatgaatgccat
gatgttggtagtgttctcctggcagtcctttttgaaaatggaaacattgcagtgtggcag
ttccagctcccatttattggcaaggaatccatttcttcatgcaacaccattgaatctggg
attacctctcctagtgttttgttttggtgggaatacgaacacaacaatagaaagatgagt
gggcttattgtgggtagtgcatttgggcctgttaaaattcttcctgttaacctcaaagca
gttaagggctacttcacattaagacaaccagttattttatggaaagaaatggaccagttg
ccagtacacagtattaaatgtattcctctttatcatccttaccagaaatgtagttgtagc
ttagtggtggctgctaggggatcctatgtattttggtgtcttcttctgatatccaaagca
ggtctgaatgtccataattcgcatgtcacaggacttcacacactaccaattgtttccatg
actgcagacaaacaaaatggtacagtatacacatgctcaagtgatggaaaggtcaggcag
ttgatacccatttttacagatgttgcattaaagtttgagcaccagctgattaaactatca
gaagtatttggctcagtgaggactcatgggatatcagtaagcccctgtggtgcatacctg
gcagtcattacaactgagggtatgatcaatggtctccaccctgttaacaaaaactatcag
gttcaatttgtaactctcaaaacatttgaagaggcagcagctcaacttctggaatcttca
gttcaaaacctctttaagcaagtggacttattagatctggtacgctggaaaattttgaaa
gacaaacatatccctcagtttttacaagaagccttggacaaaaagattgaaagttctgga
tcgacttacttttggcgttttaaacttttccttttgcgaattttataccagtcaatgcag
aaaaccccctcagaagtcttatggaagcccacccacgaggacaacaaaatcttaatatcc
gattctcttgggctgggccatactgaggaggaacaccaggaagaaggaacttctttcaaa
caaataggtaagccaggtggccatgagaggaacaaagaaagagatgctgaagatctagct
gacagttcacccatccagtctggagatgcaggccgtgagccaatggaagaaaaactcctt
gaaatccaaggaagaattgaagctgttgaaatgcatttaactagggaacatatgaagagg
gttttgggagaagtatacctccacacatggatcacagagaacactggcatccccactaga
ggactctgtgacttcttaatgtctgatgaaggctatgatgacagaacagctcgggtgctc
atcgggcacatctcaaagaagatgaacaaacagactttccctgagcactgcagcttgtgt
aaagaaattttgcctttcacagaccgtaagcaagcagtttgctccaatgggcacatttgg
cttcggtgctttttaacctaccagtcctgccagagtttgatatacagaaggtgtttgctt
catgacagcattgcacggcatccaactccagaagatcctgactggataaagaggttattg
caaggcccttgtccattctgcgactcccccgttttctaa

DBGET integrated database retrieval system