KEGG   Monodelphis domestica (opossum): 100017640Help
Entry
100017640         CDS       T01031                                 

Gene name
IL1R2
Definition
interleukin 1 receptor, type II
Orthology
K04387  
interleukin 1 receptor type II
Organism
mdo  Monodelphis domestica (opossum)
Pathway
MAPK signaling pathway
Cytokine-cytokine receptor interaction
Hematopoietic cell lineage
Amoebiasis
HTLV-I infection
Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100017640 (IL1R2)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100017640 (IL1R2)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    100017640 (IL1R2)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    100017640 (IL1R2)
  Infectious diseases
   05166 HTLV-I infection
    100017640 (IL1R2)
   05146 Amoebiasis
    100017640 (IL1R2)
Cellular antigens [BR:mdo04090]
 Proteins
  100017640 (IL1R2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 414 aa AA seqDB search
MQNHRPLDTGPQISVSCFQKRYGLFFFLYALVVNVSASSIQLQESTENCQDFGDNFIRFV
VEGEPVVLKAPFLRDFFSLPYKLSWHKNDSEKTVLGVGESGRTWIKDNALWIVPASVEDT
GTYICTIRNESYCATKSIELKVLKKMTASLHLISYRQTVVSSSPGRLVCPEINDFIQKTN
KMEIKWYKDSVLLDESNKKFSILKGSTDCHINNVSLNNSGYYTCELPFVHGNVKYNITRH
IKLRVLKKKEDSFPVIILPNKTISTSLGSKLIIPCKAFFGLGPQSTMLLWWTANKTFVDN
VYKEGRVKEGQHHKYLENNKSYLEAPLIFDSVEKKDLYTEFVCTARNRLGSQTLHARVKE
EPPFSWGIAVAPLSLILLVFVGIWIHRRWKQRSGKAYTPGKSKIISHECQPYTP
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaccacagacctctagatactggacctcaaatttcagtttcctgcttccagaaa
cgatatggattgttcttctttctttatgcattggtggtgaatgtttctgcatccagcatt
cagctccaggaaagcacagaaaactgccaggatttcggagacaattttataagattcgtg
gtagaaggagaacctgtggtcctgaaagcaccttttctgcgggatttcttcagtctcccc
tataagctatcatggcataaaaatgattcagagaagactgttctaggagtgggtgaatca
ggcagaacatggataaaagacaatgccctctggattgtgccagcttcagtggaggacaca
ggaacttacatttgcaccattaggaatgaatcttattgtgccacaaaatctattgaatta
aaggtcttaaagaagatgacagcttctctacacttaatttcttatcgccaaactgtggtc
tcttcaagtcctggaaggctagtgtgccctgaaataaatgattttatccaaaagacaaat
aaaatggaaataaaatggtataaggattcagttcttttggatgaaagcaataagaagttc
tcaatattgaaaggatccactgactgccatataaacaatgtatccctgaacaactctggt
tactacacctgtgagcttccttttgtccatggaaatgtgaagtataacatcaccaggcac
attaagctccgtgtcctgaaaaaaaaggaggattcttttcctgtgattatcttacccaat
aagacaatatcaacttctcttggttcaaaactgatcattccctgcaaagcatttttcggc
ttgggcccacagtctacgatgcttttgtggtggacagcgaacaagacttttgtggataat
gtctataaagaagggcgagtgaaggaaggacaacaccataaatatttagaaaacaataaa
agctaccttgaagcacctctgatatttgattcagtggaaaagaaggatttgtacactgaa
tttgtatgtacagccaggaacagattgggatcccagactttgcatgcaagagttaaagaa
gaacctccattctcctggggaattgctgtggctccactctcactcatcttgttggtcttt
gttggcatatggatacatagaaggtggaaacagaggtctgggaaagcatatactcctggc
aaatcaaagattatcagtcatgaatgtcaaccctatactccttaa

DBGET integrated database retrieval system