KEGG   Monodelphis domestica (opossum): 100017640Help
Entry
100017640         CDS       T01031                                 

Definition
interleukin-1 receptor type 2-like
Orthology
K04387  
interleukin 1 receptor type II
Organism
mdo  Monodelphis domestica (opossum)
Pathway
MAPK signaling pathway
Cytokine-cytokine receptor interaction
Hematopoietic cell lineage
Amoebiasis
HTLV-I infection
Transcriptional misregulation in cancer
Class
Environmental Information Processing; Signal transduction; MAPK signaling pathway [PATH:mdo04010]
Environmental Information Processing; Signaling molecules and interaction; Cytokine-cytokine receptor interaction [PATH:mdo04060]
Organismal Systems; Immune system; Hematopoietic cell lineage [PATH:mdo04640]
Human Diseases; Cancers; Transcriptional misregulation in cancers [PATH:mdo05202]
Human Diseases; Infectious diseases; HTLV-I infection [PATH:mdo05166]
Human Diseases; Infectious diseases; Amoebiasis [PATH:mdo05146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 395 aa AA seqDB search
MHLENQQPCSQNSFHTHVEAVSLESGRQNCQDFGDNFIRFVVEGEPVVLKAPFLRDFFSL
PYKLSWHKNDSEKTVLGVGESGRTWIKDNALWIVPASVEDTGTYICTIRNESYCATKSIE
LKVLKKMTASLHLISYRQTVVSSSPGRLVCPEINDFIQKTNKMEIKWYKDSVLLDESNKK
FSILKGSTDCHINNVSLNNSGYYTCELPFVHGNVKYNITRHIKLRVLKKKEDSFPVIILP
NKTISTSLGSKLIIPCKAFFGLGPQSTMLLWWTANKTFVDNVYKEGRVKEGQHHKYLENN
KSYLEAPLIFDSVEKKDLYTEFVCTARNRLGSQTLHARVKEEPPFSWGIAVAPLSLILLV
FVGIWIHRRWKQRSGKAYTPGKSKIISHECQPYTP
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgcacttggagaatcagcagccctgctctcagaacagctttcatacgcatgtggaggca
gtaagcctggaatcaggaagacaaaactgccaggatttcggagacaattttataagattc
gtggtagaaggagaacctgtggtcctgaaagcaccttttctgcgggatttcttcagtctc
ccctataagctatcatggcataaaaatgattcagagaagactgttctaggagtgggtgaa
tcaggcagaacatggataaaagacaatgccctctggattgtgccagcttcagtggaggac
acaggaacttacatttgcaccattaggaatgaatcttattgtgccacaaaatctattgaa
ttaaaggtcttaaagaagatgacagcttctctacacttaatttcttatcgccaaactgtg
gtctcttcaagtcctggaaggctagtgtgccctgaaataaatgattttatccaaaagaca
aataaaatggaaataaaatggtataaggattcagttcttttggatgaaagcaataagaag
ttctcaatattgaaaggatccactgactgccatataaacaatgtatccctgaacaactct
ggttactacacctgtgagcttccttttgtccatggaaatgtgaagtataacatcaccagg
cacattaagctccgtgtcctgaaaaaaaaggaggattcttttcctgtgattatcttaccc
aataagacaatatcaacttctcttggttcaaaactgatcattccctgcaaagcatttttc
ggcttgggcccacagtctacgatgcttttgtggtggacagcgaacaagacttttgtggat
aatgtctataaagaagggcgagtgaaggaaggacaacaccataaatatttagaaaacaat
aaaagctaccttgaagcacctctgatatttgattcagtggaaaagaaggatttgtacact
gaatttgtatgtacagccaggaacagattgggatcccagactttgcatgcaagagttaaa
gaagaacctccattctcctggggaattgctgtggctccactctcactcatcttgttggtc
tttgttggcatatggatacatagaaggtggaaacagaggtctgggaaagcatatactcct
ggcaaatcaaagattatcagtcatgaatgtcaaccctatactccttaa

DBGET integrated database retrieval system