KEGG   Monodelphis domestica (opossum): 100017640Help
Entry
100017640         CDS       T01031                                 

Gene name
IL1R2
Definition
(RefSeq) interleukin 1 receptor type 2
  KO
K04387  
interleukin 1 receptor type II
Organism
mdo  Monodelphis domestica (opossum)
Pathway
MAPK signaling pathway
Cytokine-cytokine receptor interaction
Hematopoietic cell lineage
Amoebiasis
HTLV-I infection
Transcriptional misregulation in cancer
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100017640 (IL1R2)
  Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    100017640 (IL1R2)
 Organismal Systems
  Immune system
   04640 Hematopoietic cell lineage
    100017640 (IL1R2)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    100017640 (IL1R2)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100017640 (IL1R2)
  Infectious diseases
   05166 HTLV-I infection
    100017640 (IL1R2)
   05146 Amoebiasis
    100017640 (IL1R2)
Cytokine receptors [BR:mdo04050]
 IL-1 receptor family
  100017640 (IL1R2)
Cellular antigens [BR:mdo04090]
 Proteins
  100017640 (IL1R2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
7
AA seq 414 aa AA seqDB search
MQNHRPLDTGPQISVSCFQKRYGLFFFLYALVVNVSASSIQLQESTENCQDFGDNFIRFV
VEGEPVVLKAPFLRDFFSLPYKLSWHKNDSEKTVLGVGESGRTWIKDNALWIVPASVEDT
GTYICTIRNESYCATKSIELKVLKKMTASLHLISYRQTVVSSSPGRLVCPEINDFIQKTN
KMEIKWYKDSVLLDESNKKFSILKGSTDCHINNVSLNNSGYYTCELPFVHGNVKYNITRH
IKLRVLKKKEDSFPVIILPNKTISTSLGSKLIIPCKAFFGLGPQSTMLLWWTANKTFVDN
VYKEGRVKEGQHHKYLENNKSYLEAPLIFDSVEKKDLYTEFVCTARNRLGSQTLHARVKE
EPPFSWGIAVAPLSLILLVFVGIWIHRRWKQRSGKAYTPGKSKIISHECQPYTP
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaccacagacctctagatactggacctcaaatttcagtttcctgcttccagaaa
cgatatggattgttcttctttctttatgcattggtggtgaatgtttctgcatccagcatt
cagctccaggaaagcacagaaaactgccaggatttcggagacaattttataagattcgtg
gtagaaggagaacctgtggtcctgaaagcaccttttctgcgggatttcttcagtctcccc
tataagctatcatggcataaaaatgattcagagaagactgttctaggagtgggtgaatca
ggcagaacatggataaaagacaatgccctctggattgtgccagcttcagtggaggacaca
ggaacttacatttgcaccattaggaatgaatcttattgtgccacaaaatctattgaatta
aaggtcttaaagaagatgacagcttctctacacttaatttcttatcgccaaactgtggtc
tcttcaagtcctggaaggctagtgtgccctgaaataaatgattttatccaaaagacaaat
aaaatggaaataaaatggtataaggattcagttcttttggatgaaagcaataagaagttc
tcaatattgaaaggatccactgactgccatataaacaatgtatccctgaacaactctggt
tactacacctgtgagcttccttttgtccatggaaatgtgaagtataacatcaccaggcac
attaagctccgtgtcctgaaaaaaaaggaggattcttttcctgtgattatcttacccaat
aagacaatatcaacttctcttggttcaaaactgatcattccctgcaaagcatttttcggc
ttgggcccacagtctacgatgcttttgtggtggacagcgaacaagacttttgtggataat
gtctataaagaagggcgagtgaaggaaggacaacaccataaatatttagaaaacaataaa
agctaccttgaagcacctctgatatttgattcagtggaaaagaaggatttgtacactgaa
tttgtatgtacagccaggaacagattgggatcccagactttgcatgcaagagttaaagaa
gaacctccattctcctggggaattgctgtggctccactctcactcatcttgttggtcttt
gttggcatatggatacatagaaggtggaaacagaggtctgggaaagcatatactcctggc
aaatcaaagattatcagtcatgaatgtcaaccctatactccttaa

DBGET integrated database retrieval system