KEGG   Monodelphis domestica (opossum): 100017763Help
Entry
100017763         CDS       T01031                                 

Gene name
BPNT1
Definition
(RefSeq) 3'(2'), 5'-bisphosphate nucleotidase 1
  KO
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    100017763 (BPNT1)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     100017763 (BPNT1)
Transfer RNA biogenesis [BR:mdo03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    100017763 (BPNT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Position
2
AA seq 311 aa AA seqDB search
MLIMASSPTVLIRLVASAYSIAQKAGMIIRNVMAGGDLGIVEKTSSIDLQTKADRLAQMS
ICSSLARKFPKLTIIGEEDLPVEEVDQDLIEDGQWEEILKKPCPTQYSSIKEEDLVVWVD
PVDGTKEYTEGLLDNVTVLIGIAYEGKAIAGVINQPYYNYQEGKDAVLGRTIWGVLGLGA
FGFQLNEVPDGKHIITTTRSHSNKLVNDCISAMNPDEVLRVGGAGNKIIQLIEGKASAYV
FASPGCKKWDTCAPEVILHAVGGKLTDIHGNALQYHKEVKHMNSAGVLATLRNYDYYAGC
VPETVKNALVP
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgttaatcatggcttccagtccaactgtcttgatccgtttggttgcttctgcatattct
attgctcagaaagctggaatgataatcagaaatgtgatggctgggggcgaccttggaatt
gtggagaagacatcctcaatagatttacaaaccaaagctgaccgactggcacagatgagt
atatgttcttcattggcacggaaattccccaagctaacaataataggagaagaggatctg
cctgttgaagaggtagatcaagatctgattgaagatggtcagtgggaggaaattctgaag
aaaccttgcccaacacaatatagttctatcaaagaggaagatcttgttgtatgggttgat
cctgtggacggtaccaaggaatacactgaaggtcttctggacaatgtaacagttcttatt
gggattgcttatgaaggaaaagcaatagcaggagttattaaccaaccttactacaactat
caggaaggaaaagatgccgtgctggggaggacaatctggggagttttaggtttgggtgct
tttgggtttcagctgaatgaagtgcctgatgggaaacatataattaccacaacccgttct
cattccaacaagttggtaaatgattgcatttctgctatgaatcctgatgaagttctcaga
gtgggaggagcaggaaataagatcattcagctgattgaaggcaaggcatctgcttatgta
tttgctagtcctggctgtaagaagtgggatacttgtgctccagaagttattttacatgct
gtaggaggcaaattgactgatattcatggaaatgcccttcaataccataaggaagtaaag
catatgaattctgctggtgtccttgccacattgaggaattatgattactatgcaggctgt
gttccagagactgttaaaaatgcacttgtaccatga

DBGET integrated database retrieval system