KEGG   Monodelphis domestica (opossum): 100017802Help
Entry
100017802         CDS       T01031                                 

Gene name
ADRA1A
Definition
adrenoceptor alpha 1A
Orthology
K04135  
adrenergic receptor alpha-1A
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Calcium signaling pathway
cGMP-PKG signaling pathway
Neuroactive ligand-receptor interaction
AMPK signaling pathway
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Salivary secretion
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100017802 (ADRA1A)
   04022 cGMP - PKG signaling pathway
    100017802 (ADRA1A)
   04152 AMPK signaling pathway
    100017802 (ADRA1A)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100017802 (ADRA1A)
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100017802 (ADRA1A)
   04270 Vascular smooth muscle contraction
    100017802 (ADRA1A)
  Digestive system
   04970 Salivary secretion
    100017802 (ADRA1A)
G protein-coupled receptors [BR:mdo04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Adrenaline [Table]
    100017802 (ADRA1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 375 aa AA seqDB search
MVFFPENASDSSNCTHAQEPVNISKAILLGVILGSLILFGVLGNILVILSVACHRHLQSV
THYYIVNLAVADLLLTSTVLPFSAILEILGYWAFGRIFCNIWAAVDVLCCTASIMGLCII
SIDRYIGVSYPLRYPTIVTQKRGLLALMCVWALSLTISIGPLFGWKEQPPEDETICQITE
EPGYVLFSALGSFYIPLAIILVMYCRVYVVAKRESKGLKHGLKTDKSDSEQVTLRIHRKN
IPSASSSGSSSKNKTHFSVRLLKFSREKKAAKTLGIVVGCFILCWLPFFLVMPIGSFFPE
SKPSDTVFKIAFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRAQCLRRKQSTKHAIGYTL
NPPSHAIGEHKDLDF
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggtgtttttccctgagaatgcctcggacagctcgaactgtacccatgcgcaggagcca
gtgaatatctccaaggccattctactgggtgtgatcttgggcagtctcatcctttttggg
gtgctgggaaacatcctggtgattctttctgtagcctgccaccgtcacctccagtctgtc
acccactactatatcgtcaacttggcagtagctgacctgctcctcacctccacagtgctc
cccttctcagccatcttggagatcctgggctactgggcctttggtagaatcttctgtaac
atctgggcagctgtggatgtcctgtgctgcacagcctccatcatgggcctgtgcataatc
tccattgacaggtatattggggtcagctaccctctgcgttaccctaccatcgtgacccaa
aaaagaggactcttggctttgatgtgtgtctgggctctctccctgaccatttccattgga
cctctctttggctggaaagagcagccccctgaggatgagactatctgtcagatcactgaa
gagccaggctacgtgctcttctcagccctgggatccttctacatccccttggccatcatc
ctggtgatgtactgcagagtgtatgtggtggccaagagggaaagtaaaggcctcaagcat
ggcctgaagacagacaagtcagactcagagcaggtgacactccgaatccatcgaaaaaac
attccctctgccagcagctctggatcgagctccaagaacaagacacatttctctgtgagg
cttttaaagttttccagggagaagaaagcagcaaagactctgggcattgtcgtgggctgc
ttcatcctctgctggctccccttcttcttagtgatgccaattgggtctttcttccctgaa
tctaagccctcggatactgtttttaaaatagccttttggctcggatacttaaacagctgc
atcaaccccatcatctatccttgttccagtcaagagtttaaaaaggcatttcagaatgtc
ctgagagcccagtgtctacgaagaaaacagtccacaaaacatgccattggctataccctc
aacccacccagccacgccataggagagcacaaggacttggatttttaa

DBGET integrated database retrieval system