KEGG   Monodelphis domestica (opossum): 100017802Help
Entry
100017802         CDS       T01031                                 

Gene name
ADRA1A
Definition
(RefSeq) adrenoceptor alpha 1A
  KO
K04135  adrenergic receptor alpha-1A
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo04020  Calcium signaling pathway
mdo04022  cGMP-PKG signaling pathway
mdo04080  Neuroactive ligand-receptor interaction
mdo04152  AMPK signaling pathway
mdo04261  Adrenergic signaling in cardiomyocytes
mdo04270  Vascular smooth muscle contraction
mdo04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    100017802 (ADRA1A)
   04022 cGMP - PKG signaling pathway
    100017802 (ADRA1A)
   04152 AMPK signaling pathway
    100017802 (ADRA1A)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100017802 (ADRA1A)
 Organismal Systems
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100017802 (ADRA1A)
   04270 Vascular smooth muscle contraction
    100017802 (ADRA1A)
  Digestive system
   04970 Salivary secretion
    100017802 (ADRA1A)
G protein-coupled receptors [BR:mdo04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Adrenaline [OT]
    100017802 (ADRA1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4 GPI2
Motif
Other DBs
NCBI-GeneID: 100017802
NCBI-ProteinID: XP_001371245
Ensembl: ENSMODG00000016673
Position
1
AA seq 375 aa AA seqDB search
MVFFPENASDSSNCTHAQEPVNISKAILLGVILGSLILFGVLGNILVILSVACHRHLQSV
THYYIVNLAVADLLLTSTVLPFSAILEILGYWAFGRIFCNIWAAVDVLCCTASIMGLCII
SIDRYIGVSYPLRYPTIVTQKRGLLALMCVWALSLTISIGPLFGWKEQPPEDETICQITE
EPGYVLFSALGSFYIPLAIILVMYCRVYVVAKRESKGLKHGLKTDKSDSEQVTLRIHRKN
IPSASSSGSSSKNKTHFSVRLLKFSREKKAAKTLGIVVGCFILCWLPFFLVMPIGSFFPE
SKPSDTVFKIAFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRAQCLRRKQSTKHAIGYTL
NPPSHAIGEHKDLDF
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggtgtttttccctgagaatgcctcggacagctcgaactgtacccatgcgcaggagcca
gtgaatatctccaaggccattctactgggtgtgatcttgggcagtctcatcctttttggg
gtgctgggaaacatcctggtgattctttctgtagcctgccaccgtcacctccagtctgtc
acccactactatatcgtcaacttggcagtagctgacctgctcctcacctccacagtgctc
cccttctcagccatcttggagatcctgggctactgggcctttggtagaatcttctgtaac
atctgggcagctgtggatgtcctgtgctgcacagcctccatcatgggcctgtgcataatc
tccattgacaggtatattggggtcagctaccctctgcgttaccctaccatcgtgacccaa
aaaagaggactcttggctttgatgtgtgtctgggctctctccctgaccatttccattgga
cctctctttggctggaaagagcagccccctgaggatgagactatctgtcagatcactgaa
gagccaggctacgtgctcttctcagccctgggatccttctacatccccttggccatcatc
ctggtgatgtactgcagagtgtatgtggtggccaagagggaaagtaaaggcctcaagcat
ggcctgaagacagacaagtcagactcagagcaggtgacactccgaatccatcgaaaaaac
attccctctgccagcagctctggatcgagctccaagaacaagacacatttctctgtgagg
cttttaaagttttccagggagaagaaagcagcaaagactctgggcattgtcgtgggctgc
ttcatcctctgctggctccccttcttcttagtgatgccaattgggtctttcttccctgaa
tctaagccctcggatactgtttttaaaatagccttttggctcggatacttaaacagctgc
atcaaccccatcatctatccttgttccagtcaagagtttaaaaaggcatttcagaatgtc
ctgagagcccagtgtctacgaagaaaacagtccacaaaacatgccattggctataccctc
aacccacccagccacgccataggagagcacaaggacttggatttttaa

DBGET integrated database retrieval system