KEGG   Monodelphis domestica (opossum): 100017917Help
Entry
100017917         CDS       T01031                                 

Definition
histo-blood group ABO system transferase 1-like
Orthology
K00709  
histo-blood group ABO system transferase [EC:2.4.1.40 2.4.1.37]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Glycosphingolipid biosynthesis - lacto and neolacto series
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00601 Glycosphingolipid biosynthesis - lacto and neolacto series
    100017917
Enzymes [BR:mdo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.37  fucosylgalactoside 3-alpha-galactosyltransferase
     100017917
    2.4.1.40  glycoprotein-fucosylgalactoside alpha-N-acetylgalactosaminyltransferase
     100017917
Glycosyltransferases [BR:mdo01003]
 Glycan extension
  ABO blood group
   100017917
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 357 aa AA seqDB search
MNSKTKDCLSKTYRDWLWVILVLAAFLGGYSTYFILEHHSSSPEPATQSVQHHEKPKIEL
QTVPQSVQHHEKPKIELQTASQRRIDVPLLTPWLAPIVWDGTFDEDILNEQFQGRNITIG
VTIFAIKKYVIFLKLFLETAEKHFMVGYKVNYYVFTDRPNDVPKIPLQEGRKIITLVVQN
YSRWQDISMHRMEMISNYCHQLFFKDVDYLVCLDVDMKFNDHVGVEMLSDLVGTLHPGFY
GASRETFTYERRPKSQAYIPRGKGDYYYMGGFFGGKVQQVYKLTKACHEAMLIDKSNRIE
AVWHDESHLNKYLFLHKPTKVLPPEYMWDKQLLGWPAFLRKMRMLAVPKNHAKIRNK
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgaattccaagacaaaagactgtctaagtaaaacttacagggactggctgtgggtgata
ttggtgttggctgctttcctgggtggctacagcacctatttcattctggaacaccatagc
tcttcaccagaaccagccacacaaagtgtccaacatcatgaaaagcccaagattgaactt
caaactgtgccacaaagtgtccaacatcatgaaaagcccaagattgaacttcaaactgcg
tcacaaaggcgcatcgatgtcccactcctgactccttggcttgcacccattgtttgggat
ggaactttcgatgaggacatcttgaatgaacagttccaaggcaggaatatcaccattgga
gtgacaatatttgcaatcaaaaagtatgttatcttcctgaagctgtttcttgaaactgca
gagaagcatttcatggtgggatacaaagtgaattactatgtgttcactgaccggccaaat
gatgttccaaaaatacccctccaagaaggaaggaaaatcatcacgttggtggtccaaaac
tattccaggtggcaagatatctctatgcaccggatggaaatgattagcaattattgtcat
cagctcttcttcaaggatgtagattacctcgtatgtctggatgtagacatgaagtttaat
gatcatgtcggggtagagatgctttctgacttggttggcactcttcatcctggcttttat
ggagcttctcgggaaaccttcacctatgaacgccgccctaaatcccaagcctacattccc
agaggcaagggtgattattattatatggggggtttttttggaggcaaagtacaacaggtt
tataaattgaccaaggcttgtcatgaagctatgttgattgacaaaagtaataggattgaa
gcagtgtggcatgatgagagccatttaaacaaatacctatttcttcacaaacccaccaaa
gtccttcccccagaatatatgtgggataaacaactcttagggtggccagccttcctcagg
aaaatgaggatgttggctgtgccaaagaaccatgctaagattcggaacaagtaa

DBGET integrated database retrieval system