KEGG   Monodelphis domestica (opossum): 100017939Help
Entry
100017939         CDS       T01031                                 

Gene name
USP35
Definition
ubiquitin specific peptidase 35
Orthology
K11854  
ubiquitin carboxyl-terminal hydrolase 35/38 [EC:3.1.2.15]
Organism
mdo  Monodelphis domestica (opossum)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 1036 aa AA seqDB search
MDKILEAVMLSSYPTNVKQGLARRVIEAAKQPMDSAQCWAMLELSTKLYLMGDTKFKREI
GQEVLEVYGHYHLEAFVEFFNAHFLLTLLQEGYGTPGHPSPYVLDYVQLGLQFIPEGPAA
EGVFALLRLEVLRKVCERPGPRQCAKVARLLSQYPRCIPDGRHRLLFCQQLVRCIGQFQC
LAEGEEGIVEFLSHVNRVSGLLPKIWRAQASSILPSLKELFAIISSTEEQEPPSNALASV
VQYVPLELMDGVIRNLTNDDSITDAQMMTAISRMIDWVCWPLGKNIDKWIITLLKGLAAV
KKFSILIEVSLSKIEKVFSKLLYPIVREAALSVLKYMLLSFQHSHEAFHLLLPHIPKMVA
SLAEEDSNSRANCLEELAELIHCMVFRFSGFPDLYEPVMEAIKDLHVPNEDRIKQLLGQN
AWTSQKNELVCFYPRLAAKSDTGKIGLINLGNTCYMNSVIQALFMASDFRHCVLHLPEDN
SQPLMTKLQWLFAFLEHSQRPAVSPESFLSASWTPWFSPGAQQDCSEYLKYLLDRLHEEE
KTGKRICQKLKQSSTPSPSDEQPNLSPTAIEKMFGGKIVTRIRCLRCLNVSTREEAFTDL
SLAFPPPDRRRRRLGSVMLPVEDIRVQGTPSPAKTQAMGSEGSRRQRKHCIAGDALPPLV
NIEILGFQEPGRKKAEKKEVKKEEEEKKEMKKKEEMKKEEEEKKKEVEKREEEKVERKEE
KKEMEKKEMKEEKEEGCLGPRTGGNQGVACGEQMCGPEGSRSVPDLLNYFLSPETLTAEN
RYHCEHCASLQDAEKVVELSEGPRYLILTLLRFSFDLRTMRRKKILDNVSIPLFLRLPVG
GGCPQQDQGQACAAYDLCSVVVHSGISSESGHYYCYAREGATARVNPARSPGLSPAEKLS
GLESQWYLFNDTRVSFSSFESVSNVTSFFPKDTAYVLFYRQRAREGLAAEPKSPRPHSEP
TLHKDLIEAISKDNILYLQEQEKEARSRSAYISTLPKSPPWGRDFDEDKDEDDEGSPGGC
DPAAGGSGSSFHRLVF
NT seq 3111 nt NT seq  +upstreamnt  +downstreamnt
atggacaagatcctggaagccgtgatgctgtcatcctaccccaccaacgtgaagcaaggg
ctggcacggcgggtgatcgaggcagcaaagcagcccatggacagtgcgcagtgttgggcc
atgctggagctgtccaccaaactctacctaatgggtgacaccaagttcaagcgggagatt
gggcaggaggtcctggaagtctatggccactaccaccttgaggcctttgtggagttcttt
aatgctcatttcctcctgactctgctgcaggagggctatgggaccccaggccaccccagc
ccctatgtgctagattacgtccagctgggcctccagttcatccccgagggcccagccgct
gagggggtctttgccttactccgcctggaagtcctgagaaaggtgtgcgaacggcccggc
cccaggcagtgtgccaaggtggctcgcctgctgagccagtacccacgctgcattccagat
ggcagacaccggctgctcttctgccagcagctggttcgctgcatcgggcaattccagtgc
ctggcagagggggaggagggcattgtggagttcttgagccacgtgaaccgagtgagtggg
ctcttacctaaaatctggagggcccaagcttcctccatcctgccatctctgaaggagctg
tttgccatcatctcctccacagaggagcaggagcctccctccaatgccctggccagcgtc
gtccagtacgtgcccctggagctcatggacggggtgatcaggaacctcaccaatgacgat
agcatcacagatgcccagatgatgacagctatcagcaggatgatcgactgggtgtgttgg
cccctggggaaaaacatagacaagtggatcatcacgttgctaaagggcctagcagctgtt
aagaagttcagcattttgattgaagtctctctctccaaaatagagaaggttttctccaaa
ctactctaccctattgtgagggaggctgcgctatctgtcctcaagtatatgcttctgagt
ttccagcactcccatgaagccttccacctgcttctccctcacattcccaaaatggtggcc
tccctggcagaagaggactccaactcccgagccaattgcctggaagagctggcagagtta
atccactgcatggtgttccgcttctcgggcttcccagacctctatgagccggtcatggag
gccatcaaggacctccatgttcccaatgaagaccgcatcaagcagctgctgggacagaac
gcctggacctctcagaagaatgagctggtctgtttctacccccggctggctgctaagtcg
gacacaggcaagatcggcctcatcaacctggggaacacctgttacatgaacagcgtgatc
caggcgctgtttatggcctctgactttcgacactgcgtcctgcatctgcccgaggacaat
tcccagcccctgatgaccaagttgcagtggctttttgccttcctcgaacacagccagcgg
cccgctgtctccccggagagcttcctgtctgcttcttggacgccctggttcagtcctggt
gcccagcaggactgctctgaatacctgaagtatttgttggatcgattgcatgaagaggag
aaaacagggaagaggatttgccagaagctcaaacagtccagcacaccatctccatcagat
gagcaaccaaacctaagtccaacagctatagagaaaatgtttggtgggaagattgtgacc
cgaatccgttgtctccgttgtctcaatgtttccaccagggaggaagcattcacagacctc
tcactggcctttccaccccctgaccgccgccgtcgtcgcctgggttctgttatgctgcca
gtggaagatatcagggttcaaggcaccccatcaccagccaagacccaggccatggggagt
gaggggtcccggagacagagaaagcactgtattgctggggatgctctgcccccactggta
aatattgagatccttggattccaggagccagggagaaagaaggcagaaaagaaggaagtg
aaaaaggaggaggaagaaaaaaaagagatgaagaaaaaggaggaaatgaagaaggaagaa
gaggaaaaaaagaaagaagtggaaaaaagggaggaagagaaggtggagagaaaggaagaa
aagaaggagatggagaaaaaggagatgaaggaagagaaagaagaaggttgcctaggccca
aggactggtgggaaccagggggttgcctgtggggagcagatgtgtggccctgagggctct
cgttctgtcccagatcttctcaattactttctgtctccagagacgttgacagcagagaac
cgctatcactgtgagcactgtgcctcgttgcaggatgcagagaaggtggtggagctgagt
gagggaccccgctacctcatcctcaccctgctgcgcttctctttcgacctaaggaccatg
cgtcggaagaagatcctggacaacgtctccattcccctgttccttcggcttcccgtgggg
ggtggctgcccccagcaggaccagggccaggcctgtgcggcctatgacctttgcagtgtc
gtggtgcactcgggcatctcttcagaaagtggtcattactactgctatgcccgcgaggga
gcgacagccagagtcaacccagcccgttccccgggactctcgcctgctgaaaagctatca
ggcctggagagccagtggtatttgttcaatgacacccgggtctccttctcctccttcgag
tcagttagcaatgtcacttccttctttcccaaagacacagcttatgtgctgttctacagg
cagagagccagagaggggctcgcagcagaacccaagtcacccagacctcacagtgaacca
actctgcacaaagacttgattgaagccatatctaaagacaacattctttacctgcaggag
caagaaaaggaggccaggagcagatcagcctacatctccacgctccccaaatctccccct
tgggggagggactttgacgaagacaaggatgaggatgatgaaggctccccggggggctgt
gaccctgcagctggaggcagtggcagctccttccacagacttgtcttctag

DBGET integrated database retrieval system