KEGG   Monodelphis domestica (opossum): 100017989Help
Entry
100017989         CDS       T01031                                 

Definition
acetylcholinesterase-like
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Glycerophospholipid metabolism
Cholinergic synapse
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:mdo00564]
Organismal Systems; Nervous system; Cholinergic synapse [PATH:mdo04725]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
2
AA seq 728 aa AA seqDB search
MPMFLSLDIISIVVFCRLCRCYVYLYNWVYPSLRVSVSVTPHLRGSEPHQRSCRLQREGR
GRGGISVLIWGILILGWKYRNSSSCCPQNRGRLAVSSPLPNAYSTPSPSPGDHWTRTRMA
IGLSLLHLHSPSPPLLLLLFLLGRGLEAETIKDSDLLVTVKGGKLRGIHLNAPGGPVSAF
LGIPFAEPPVGPRRFLPPEPKRPWNGVLDAISFPHVCYQYVDNLYPGFQGSEMWNPNREL
SEDCLYLNVWTPSPRPVVPAPVLVWIYGGGFYSGATSLDVYDGRFLARVEGTVLVSMNYR
VGAFGFLALPGSREAPGNVGLLDQRLAMQWVKDNVAAFGGDPRSVTLFGESAGAASIGMH
LLSPPSRGLFHRAVLQSGTPNGPWATVGAGEARRRATLLARLVGCPTGSNDTELVVCLRT
RPAQDLVDQEWQVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDFHGLQVLVGVVQDEG
SYFLVYGAPGFSKDNESLINRAQFLAGVQVGVPQASELAAEAVVLHYTDWLHPDDPARLR
EALGDVVGDHNVVCPVAQLAGGLAAQGARVYVYVFDHRASTMSWPLWMGVPHGYEIEFIF
GLPLEPTLNYTGPERVLARRLMRYWANFARTGDPNEPRERESPRWPPYTAGAQQYVSLNL
RPLEVRRGLRAQACAFWNRFLPKLLSATDSLDEAERQWKAEFHRWSSYMVHWKNQFDHYS
KQERCSDL
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgccgatgtttctctcactggatatcatctctatagttgtgttttgtcgtttgtgtcgg
tgttacgtctatctctataactgggtctacccctccctgcgtgtcagtgtctctgtcact
ccccacctccgcggctcagaacctcatcagagatcctgcaggcttcagcgagaggggcgg
gggaggggggggatttccgtcctgatctggggaattttgatccttggatggaaataccgg
aacagcagcagctgctgtccccaaaatagaggccggctggccgtcagttcccctctcccc
aacgcctactccaccccctctcccagcccgggggaccactggactcgcaccaggatggcc
attggactctctctactgcatctccacagtccttccccaccccttctcctcctcctcttt
ctcctgggtagggggctagaggctgaaaccattaaggattctgacctgctggtgacagta
aaggggggaaagcttcgtgggatccacctcaatgccccagggggtcctgtttctgccttt
ctgggtatcccttttgctgaacccccagtgggacctaggcgctttttgcctccagaaccc
aaacggccatggaatggggtcttagatgctatatccttccctcatgtctgctaccaatat
gtggacaacctgtatccaggtttccaggggtctgaaatgtggaaccctaatcgagagcta
agtgaagactgcctatatctcaatgtgtggacaccctccccccgaccagtggttcctgca
ccagtcctggtctggatctatgggggtggcttctatagtggggccacctcccttgatgtt
tatgatggacgattcctggctagagttgaaggcactgtgctcgtttccatgaattatcga
gttggtgcctttggcttcctggcactgccagggagccgggaagcaccaggcaatgtgggg
ctgctggaccagcgcctagcaatgcaatgggtgaaggacaacgtggcagccttcggagga
gacccaaggtcagtgacactctttggggagagtgctggagctgcctctataggcatgcac
ctgctttcacctccaagccgtgggctcttccatagggcagtgttgcagagtgggactcct
aatggaccctgggccactgtgggggcaggtgaggctcgtcgtcgagccaccctgctggcc
cggctggtggggtgtcccactggcagcaatgacacagagttggtggtctgcctgaggacc
cgtccagcccaggaccttgtggaccaggaatggcaggtgctgccccaagagagtgtcttc
cgattctcctttgttcctgttgtggatggagacttcctcagtgacacgcctgaggccctc
atcaatgctggggactttcatggcctccaggtgttggtaggtgtagtacaggatgagggc
tcctatttcctggtctatggggcccctggcttcagcaaggataatgaatctctgatcaac
cgagcccagttcctggccggtgtgcaggttggggtacctcaagcaagcgagctggcagca
gaggctgtggttctacactacacagactggctacatcctgacgaccctgcacggcttcgt
gaagccttgggtgatgttgtgggtgaccacaacgtagtatgtcctgtggcccagctagcc
ggaggacttgctgcacagggtgcccgtgtttatgtctatgtctttgaccatcgagcttca
acaatgtcctggcccctctggatgggtgttccccatggctatgagattgaatttatcttt
ggccttccccttgaaccaactctcaactacactggtcctgagcgagttctcgcccgacgc
ctgatgagatactgggccaactttgcccgtacaggcgatcccaacgagcctcgggagcgt
gaatccccgcgctggcctccctacaccgccggggctcagcaatacgtaagcctcaacctg
cggccactagaagtgcggcgagggctgcgcgcgcaggcctgcgccttctggaaccgattt
ttgccgaagttgctcagcgccaccgatagtctggatgaggcagaacgccagtggaaggcg
gagttccaccgctggagctcctatatggtgcactggaagaaccagttcgaccattacagc
aaacaggagcgctgctctgacctgtga

DBGET integrated database retrieval system