KEGG   Monodelphis domestica (opossum): 100017989Help
Entry
100017989         CDS       T01031                                 

Gene name
ACHE
Definition
acetylcholinesterase (Yt blood group)
Orthology
K01049  
acetylcholinesterase [EC:3.1.1.7]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Glycerophospholipid metabolism
Cholinergic synapse
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100017989 (ACHE)
 Organismal Systems
  Nervous system
   04725 Cholinergic synapse
    100017989 (ACHE)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.7  acetylcholinesterase
     100017989 (ACHE)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2
AA seq 623 aa AA seqDB search
MFASLMKTTIGTRMAIGLSLLHLHSPSPPLLLLLFLLGRGLEAETIKDSDLLVTVKGGKL
RGIHLNAPGGPVSAFLGIPFAEPPVGPRRFLPPEPKRPWNGVLDAISFPHVCYQYVDNLY
PGFQGSEMWNPNRELSEDCLYLNVWTPSPRPVVPAPVLVWIYGGGFYSGATSLDVYDGRF
LARVEGTVLVSMNYRVGAFGFLALPGSREAPGNVGLLDQRLAMQWVKDNVAAFGGDPRSV
TLFGESAGAASIGMHLLSPPSRGLFHRAVLQSGTPNGPWATVGAGEARRRATLLARLVGC
PTGSNDTELVVCLRTRPAQDLVDQEWQVLPQESVFRFSFVPVVDGDFLSDTPEALINAGD
FHGLQVLVGVVQDEGSYFLVYGAPGFSKDNESLINRAQFLAGVQVGVPQASELAAEAVVL
HYTDWLHPDDPARLREALGDVVGDHNVVCPVAQLAGGLAAQGARVYVYVFDHRASTMSWP
LWMGVPHGYEIEFIFGLPLEPTLNYTGPERVLARRLMRYWANFARTGDPNEPRERESPRW
PPYTAGAQQYVSLNLRPLEVRRGLRAQACAFWNRFLPKLLSATDSLDEAERQWKAEFHRW
SSYMVHWKNQFDHYSKQERCSDL
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcttccttgatgaagacaacaattggcaccaggatggccattggactctctcta
ctgcatctccacagtccttccccaccccttctcctcctcctctttctcctgggtaggggg
ctagaggctgaaaccattaaggattctgacctgctggtgacagtaaaggggggaaagctt
cgtgggatccacctcaatgccccagggggtcctgtttctgcctttctgggtatccctttt
gctgaacccccagtgggacctaggcgctttttgcctccagaacccaaacggccatggaat
ggggtcttagatgctatatccttccctcatgtctgctaccaatatgtggacaacctgtat
ccaggtttccaggggtctgaaatgtggaaccctaatcgagagctaagtgaagactgccta
tatctcaatgtgtggacaccctccccccgaccagtggttcctgcaccagtcctggtctgg
atctatgggggtggcttctatagtggggccacctcccttgatgtttatgatggacgattc
ctggctagagttgaaggcactgtgctcgtttccatgaattatcgagttggtgcctttggc
ttcctggcactgccagggagccgggaagcaccaggcaatgtggggctgctggaccagcgc
ctagcaatgcaatgggtgaaggacaacgtggcagccttcggaggagacccaaggtcagtg
acactctttggggagagtgctggagctgcctctataggcatgcacctgctttcacctcca
agccgtgggctcttccatagggcagtgttgcagagtgggactcctaatggaccctgggcc
actgtgggggcaggtgaggctcgtcgtcgagccaccctgctggcccggctggtggggtgt
cccactggcagcaatgacacagagttggtggtctgcctgaggacccgtccagcccaggac
cttgtggaccaggaatggcaggtgctgccccaagagagtgtcttccgattctcctttgtt
cctgttgtggatggagacttcctcagtgacacgcctgaggccctcatcaatgctggggac
tttcatggcctccaggtgttggtaggtgtagtacaggatgagggctcctatttcctggtc
tatggggcccctggcttcagcaaggataatgaatctctgatcaaccgagcccagttcctg
gccggtgtgcaggttggggtacctcaagcaagcgagctggcagcagaggctgtggttcta
cactacacagactggctacatcctgacgaccctgcacggcttcgtgaagccttgggtgat
gttgtgggtgaccacaacgtagtatgtcctgtggcccagctagccggaggacttgctgca
cagggtgcccgtgtttatgtctatgtctttgaccatcgagcttcaacaatgtcctggccc
ctctggatgggtgttccccatggctatgagattgaatttatctttggccttccccttgaa
ccaactctcaactacactggtcctgagcgagttctcgcccgacgcctgatgagatactgg
gccaactttgcccgtacaggcgatcccaacgagcctcgggagcgtgaatccccgcgctgg
cctccctacaccgccggggctcagcaatacgtaagcctcaacctgcggccactagaagtg
cggcgagggctgcgcgcgcaggcctgcgccttctggaaccgatttttgccgaagttgctc
agcgccaccgatagtctggatgaggcagaacgccagtggaaggcggagttccaccgctgg
agctcctatatggtgcactggaagaaccagttcgaccattacagcaaacaggagcgctgc
tctgacctgtga

DBGET integrated database retrieval system