KEGG   Monodelphis domestica (opossum): 100018123Help
Entry
100018123         CDS       T01031                                 

Gene name
SRD5A1
Definition
steroid-5-alpha-reductase, alpha polypeptide 1 (3-oxo-5 alpha-steroid delta 4-dehydrogenase alpha 1)
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Steroid hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100018123 (SRD5A1)
Enzymes [BR:mdo01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     100018123 (SRD5A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 256 aa AA seqDB search
MTLVAGLGNLELFSFLMGLSGPIFWVVQTFVGSPYGRHASASFGPPLPVKLAWSLQELPS
LLVPLYVVTCTPAKHFSHWPNRILLAMFVFHYLQRALIFPFLIRGGKPVPLFIFLSAFLF
CTFNGFLQSQYLSNYAEYSDNWIKDPRFIIGCAIWLMGMLINVYSDNILRNLRKPGETGY
KIPRGGLFEYVTAANFSGEVIEWYGYALACWSLEGIAFALFTTFNLCVRAKYHHRWYLEK
FEEYPKLRKIIIPFLY
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgacgctcgtggcgggacttggtaacttagagttgttctctttcttaatgggactctcg
gggccgatcttctgggtggtgcagacgttcgtgggatctccctatggccggcatgccagc
gccagttttggccctcctctgccagtgaagctagcatggtccttgcaggagctgccgtcc
ttgcttgtgcccctctacgtggtcacctgcaccccggccaagcacttcagccactggccc
aatcgcattctcctggccatgttcgtcttccactacctgcaaagggcattaattttccct
tttctgattcgtggaggaaagccggtaccactcttcatattcttgagtgcatttctgttc
tgcacctttaatggattcttgcaaagccaatacttgagtaattatgcagagtactctgat
aactggataaaagatccccgttttatcataggttgtgccatatggctaatggggatgcta
ataaatgtttattctgacaatatcctaagaaacttgagaaaaccaggagagactgggtac
aaaataccaagaggaggcttgtttgaatatgttactgcagccaatttctctggagaggtg
atagaatggtatggatatgctcttgcttgctggtccttggaaggcattgcatttgcacta
tttacaacctttaatttatgtgtcagagcaaaataccatcacaggtggtacctggagaaa
tttgaagagtatccaaagttaaggaaaattataattccgtttttatattaa

DBGET integrated database retrieval system