KEGG   Monodelphis domestica (opossum): 100018496Help
Entry
100018496         CDS       T01031                                 

Definition
ubiquitin carboxyl-terminal hydrolase 7-like
Orthology
K11838  
ubiquitin carboxyl-terminal hydrolase 7 [EC:3.1.2.15]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
FoxO signaling pathway
Herpes simplex infection
Epstein-Barr virus infection
Viral carcinogenesis
Class
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:mdo04068]
Human Diseases; Cancers; Viral carcinogenesis [PATH:mdo05203]
Human Diseases; Infectious diseases; Herpes simplex infection [PATH:mdo05168]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:mdo05169]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
6
AA seq 1016 aa AA seqDB search
MNHQQQQQKAGEQQLSEPEDMEMEAGDTDDPPRITQNPVINGNVAMADGHNNTEEDMEDG
SQWSWSCHAQAVLKIINYKDDEKSFSRRIITDPEKGFIEDDKVTFEVYVQADAPHGVAWD
SKKHTGYVGLKNQGATCYMNSLLQTLFFTNQLRKAVYMMPTEGDDSSKSVPLALQRVFYE
LQHSDKPVGTKKLTKSFGWETLDSFMQHDVQELCRVLLDNVENKMKGTCVEGTIPKLFRG
KMVSYIQCKDVDYRSDRREDYYDIQLSIKGKKNIFESFIDYVAVEQLDGDNKYDAGEHGL
QEAEKGVKFLTLPPVLHLQLMRFMYDPQTDQNIKINDRFEFPEQLPLDEFLQKTDPKDPA
NYILHAVLVHSGDNHGGHYVVYLNPRGDGKWCKFDDDVVSRCTKEEAIEHNYGGHDDDLS
VRHCTNAYMLVYIRESKLSEVLQAVTDHDIPQQLVERLQEEKRIEAQKRKERQEAHLYMQ
VQIVTEDQFCGHQGNDMYDEEKVKYTVFKVLKNSSLAEFVQNLSQTMGFPQDQIRLWPMQ
ARSNGTKRPAMLDNEADGNKTMIELSDNENPWTIFLETVDPEMAASGATLPKFDKDHDVM
LFLKMYDPKTRSLNYCGHIYTPISCKIRDLLPVMCERAGFSQETNLILYEEVKPNLTERI
QDYDVSLDKALDELMDGDIIVFQKDDPENDNSELPTAKEYFRDLYHRVDVIFCDKTIPND
PGFVVTLSNRMNYFQVAKTVAQRLNTDPMLLQFFKSQGYRDGPGNPLRHNYEGTLRDLLQ
FFKPRQPKKLYYQQLKMKITDFENRRSFKCIWLNSQFREEEITLYPDKHGCVRDLLEECK
KAVELCEKASGKLRLLEIVSYKIIGVHQEDELLECLSPATSRTFRIEEIPLDQVDIDKEN
EMLITVAHFHKEVFGTFGIPFLLRIHQGEHFREVMKRIQTMLDIQEKEFEKFKFAIVMMG
RHQYINEDEYEVNLKDFEAQPGNMSHPRPWLGLDHFNKAPKRSRYTYLEKAIKIHN
NT seq 3051 nt NT seq  +upstreamnt  +downstreamnt
atgaaccaccagcagcagcagcagaaagcgggggagcagcagctgagtgagccggaagac
atggagatggaagctggagatacagatgatccaccaagaattacacaaaatcctgtcatc
aatggaaatgtagcaatggccgatggacataataacacagaggaagatatggaggatggc
tcacaatggtcatggtcttgtcatgcacaagcagtgctgaagattataaattacaaagat
gatgaaaaatcattcagccgccgcatcattactgatcctgaaaaaggatttatagaagat
gacaaggttacttttgaagtctatgtgcaggcagatgctccccatggagttgcgtgggat
tccaagaagcatacgggatatgttggtttaaagaaccagggagcaacttgttacatgaac
agtttgttacaaactttatttttcacaaatcaactacgcaaggctgtatacatgatgcca
acagaaggtgatgactcatcaaaaagtgttcctttagcattacaaagagtgttctatgaa
ttacaacacagtgacaaacccgtaggaacaaaaaaactaacaaaatcatttggatgggaa
actttagacagcttcatgcaacatgatgtccaagaactgtgtcgagtgttgctagataat
gtggaaaataaaatgaaaggaacgtgtgtagaaggcaccatacctaaattatttagaggc
aagatggtgtcctatatccagtgcaaagatgtggactatcgatctgatcggagagaagat
tattatgatatccagctaagtataaaggggaaaaaaaatatatttgagtccttcatagat
tatgtggcagtggagcagctagatggtgacaataaatatgatgctggagaacatggcttg
caggaagcagaaaagggagtgaaattcctcacattgccaccagtgttacatctacaactc
atgagatttatgtatgacccacaaacggaccaaaatatcaagataaatgataggtttgag
tttcctgaacagttaccacttgatgagtttttacaaaaaactgaccccaaggatcctgca
aattatattcttcatgcagtactagtacatagtggagataatcatggtggacattatgtg
gtttatctaaaccctagaggggatggcaaatggtgtaaatttgatgacgatgttgtgtca
aggtgtacaaaggaagaagcaattgagcataattacggaggtcatgatgatgacttatca
gttcggcattgtactaatgcttatatgttagtttatatcagggaatcaaaactgagtgaa
gttttgcaagctgtcactgatcatgatattcctcaacaattggtagaacgcttacaagaa
gaaaaaagaatagaggctcaaaagaggaaggagcggcaggaagcccatctctatatgcaa
gtgcagatagtaaccgaggaccagttttgtgggcaccaaggcaatgatatgtatgatgaa
gaaaaagtaaaatatacagtcttcaaagtattaaaaaactcctcattagctgagtttgta
cagaatctttctcaaacaatgggatttcctcaggatcagattcgattatggcctatgcag
gctaggagtaatggaacaaaaagaccagcaatgttagataatgaagcagatggcaataaa
acaatgattgaactcagtgacaatgaaaatccatggacaatatttcttgaaacagtagat
cctgaaatggctgctagtggggcaacattaccaaagtttgataaagatcatgatgtaatg
ctgttcttgaagatgtatgatcccaaaacacggagtttgaattattgtggacatatctat
accccaatatcctgtaaaattcgtgacttgctcccagttatgtgtgaaagagcaggattt
tcccaagaaactaaccttatcctctatgaggaagttaaaccgaatttaacagagagaatt
caggattatgatgtgtctcttgataaagcactcgatgaactaatggatggtgacatcata
gtgtttcagaaggatgacccagaaaatgataacagtgaactaccaactgcaaaggagtat
ttcagagacctgtatcaccgtgtggatgtcattttctgtgataaaactattcctaatgat
cctggatttgttgttactttgtcaaataggatgaattattttcaggttgcaaagacagtt
gcacagaggctaaatacagatccaatgctacttcagtttttcaagtcccaaggttatagg
gatggcccaggtaatcctcttagacataattatgaaggtactttaagagatctcctgcaa
ttctttaaacccagacaacctaagaaactttactaccagcagctgaaaatgaaaataaca
gattttgaaaatcgaaggagttttaaatgtatttggctaaacagtcaatttagggaagag
gaaataacactatatccagacaaacatgggtgtgtccgggacctgttagaagaatgtaaa
aaggctgtagaactatgtgagaaagcgtcagggaaacttaggctgctagaaattgtaagc
tacaaaattattggtgtccatcaggaagatgaattgttagaatgtttatcacctgcaaca
agtcgaacgtttcgaatagaggaaatacccttggaccaggtagatatagataaagaaaat
gagatgctaatcacagtggctcatttccacaaagaggtctttggaacttttggtatacca
tttttgctcaggatacaccagggtgaacatttcagagaagtgatgaagcgaattcaaaca
atgctagatatccaggaaaaggagtttgaaaagtttaaatttgccattgtaatgatgggt
cgacaccagtacataaatgaagatgaatatgaagtcaatttgaaagattttgaggctcag
ccgggtaacatgtctcatcccaggccttggctggggcttgatcatttcaataaagcccca
aagagaagtcgctacacttaccttgaaaaggctattaaaattcataactga

DBGET integrated database retrieval system