KEGG   Monodelphis domestica (opossum): 100018790Help
Entry
100018790         CDS       T01031                                 

Gene name
CYPIIF2
Definition
cytochrome P450, family 2, subfamily f, polypeptide 2
Orthology
K07416  
cytochrome P450, family 2, subfamily F [EC:1.14.14.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Metabolism of xenobiotics by cytochrome P450
Class
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:mdo00980]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 492 aa AA seqDB search
MDWIGTGLLLLLLGITCLLLAKAAHKTKGRLPPGPRPLPLLGNLLQLRSRDMVTSLTKLS
QEYGSMFTVHLGTRPVVVLSGYDTVKEALVDKAEEFSGRGEYPVFYDFTKGNGIAFSNGE
KWKVLRRFSIQILRNFGMGKKSLEERILEEEAFLLEELKKTEGAPFDPTFVLSRSVSNII
CSVVFGSRFDYEDERLLKLVHLINENFKIMSSPWGEIYNIFPGLLQWIPGPHRSLFQNYG
SMKTLIDRIIHEHQINLDSTSPSDFIDCFLIKMAEEAKSPDSYFHMETLVKTTFILIFGG
TETVGTTLRHSFLLLMKYPQIQARVQAEIDSVVGRGRRPTLDDRSSMPYTDAVIHEVQRF
ADIIPMNLPHRLTRDTLFRGFLLPKGTDIITLLNTVHYDPSQFKTPNEFNPAHFLDSKEE
FKKSPAFMPFSAGRRLCLGEPLARMELFLYLTGILQNFTLQPLCSPEEIDLTPLSSGLGN
VPRPFQLRMVPR
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggactggatcgggacaggactgcttctactgctgctgggtatcacctgcctgctgctg
gccaaggcagcccacaaaaccaagggtcgcctgcctccaggacccagacccctgccactg
cttggcaacttgctacaactccgatctagagacatggtgacgtccctcaccaagctgagt
caggagtacggttctatgttcactgtgcacctaggcacccggcctgttgtggtcctaagt
ggatatgacacggtcaaggaggctctggtggacaaggccgaagagttctcagggcgtggg
gagtatcccgtattttatgacttcaccaagggcaacggtatcgccttctccaatggggaa
aagtggaaagtgttgaggagattttccatccagatccttcgcaattttggcatgggaaag
aaaagccttgaagaacgcatcctggaagaggaagccttccttctggaggaactgaaaaaa
actgaaggtgccccttttgatcccaccttcgtgctcagccgctccgtgtccaacatcatc
tgctcagtcgtctttggcagccgctttgactatgaggatgagcgtctgctcaagcttgtc
catctcatcaatgaaaactttaagatcatgagcagcccctggggggagatatacaacatc
ttccctggtctcctacaatggatccccggcccccatcgcagcctctttcagaactatggg
agcatgaagaccctcatcgaccgcatcatccatgagcaccagatcaacctagactccacc
agcccttctgacttcattgactgctttcttatcaagatggctgaggaagccaagagccca
gacagctacttccacatggagacactggtgaagacgacgttcatcctcatcttcggtggc
acagagactgtgggcacaacactgcgccacagcttcctacttctcatgaagtatcctcag
attcaggcccgggtgcaggcggagattgacagcgtggtggggcgggggaggcggcccacg
ctggatgaccgctcctctatgccctacacggacgcagtcatccatgaggtgcagcgcttt
gcggacatcattcccatgaacttgccgcaccggcttacccgcgacacactctttcgaggc
ttcctgctacccaagggcactgatatcatcaccctcctcaacacggttcactatgacccc
agtcagttcaagacacctaatgagttcaaccctgcccacttcctggactccaaggaggaa
ttcaagaagagcccagccttcatgcccttctctgctggtcgacgtctgtgcttaggggaa
cccctggcccgcatggagctgttcctttacctgactgggattctgcagaacttcacacta
cagccactgtgctccccggaggagattgacttgactcccctcagctcgggcttgggcaat
gtgcctagacctttccagcttcgaatggtgccccgataa

DBGET integrated database retrieval system