KEGG   Monodelphis domestica (opossum): 100018790Help
Entry
100018790         CDS       T01031                                 

Gene name
CYPIIF2
Definition
cytochrome P450, family 2, subfamily f, polypeptide 2
Orthology
K07416  
cytochrome P450, family 2, subfamily F [EC:1.14.14.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Metabolism of xenobiotics by cytochrome P450
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100018790 (CYPIIF2)
Enzymes [BR:mdo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100018790 (CYPIIF2)
Cytochrome P450 [BR:mdo00199]
 Cytochrome P450, animal type
  CYP2 family
   100018790 (CYPIIF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 492 aa AA seqDB search
MDWIGTGLLLLLLGITCLLLAKAAHKTKGRLPPGPRPLPLLGNLLQLRSRDMVTSLTKLS
QEYGSMFTVHLGTRPVVVLSGYDTVKEALVDKAEEFSGRGEYPVFYDFTKGNGIAFSNGE
KWKVLRRFSIQILRNFGMGKKSLEERILEEEAFLLEELKKTEGAPFDPTFVLSRSVSNII
CSVVFGSRFDYEDERLLKLVHLINENFKIMSSPWGEIYNIFPGLLQWIPGPHRSLFQNYG
SMKTLIDRIIHEHQINLDSTSPSDFIDCFLIKMAEEAKSPDSYFHMETLVKTTFILIFGG
TETVGTTLRHSFLLLMKYPQIQARVQAEIDSVVGRGRRPTLDDRSSMPYTDAVIHEVQRF
ADIIPMNLPHRLTRDTLFRGFLLPKGTDIITLLNTVHYDPSQFKTPNEFNPAHFLDSKEE
FKKSPAFMPFSAGRRLCLGEPLARMELFLYLTGILQNFTLQPLCSPEEIDLTPLSSGLGN
VPRPFQLRMVPR
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atggactggatcgggacaggactgcttctactgctgctgggtatcacctgcctgctgctg
gccaaggcagcccacaaaaccaagggtcgcctgcctccaggacccagacccctgccactg
cttggcaacttgctacaactccgatctagagacatggtgacgtccctcaccaagctgagt
caggagtacggttctatgttcactgtgcacctaggcacccggcctgttgtggtcctaagt
ggatatgacacggtcaaggaggctctggtggacaaggccgaagagttctcagggcgtggg
gagtatcccgtattttatgacttcaccaagggcaacggtatcgccttctccaatggggaa
aagtggaaagtgttgaggagattttccatccagatccttcgcaattttggcatgggaaag
aaaagccttgaagaacgcatcctggaagaggaagccttccttctggaggaactgaaaaaa
actgaaggtgccccttttgatcccaccttcgtgctcagccgctccgtgtccaacatcatc
tgctcagtcgtctttggcagccgctttgactatgaggatgagcgtctgctcaagcttgtc
catctcatcaatgaaaactttaagatcatgagcagcccctggggggagatatacaacatc
ttccctggtctcctacaatggatccccggcccccatcgcagcctctttcagaactatggg
agcatgaagaccctcatcgaccgcatcatccatgagcaccagatcaacctagactccacc
agcccttctgacttcattgactgctttcttatcaagatggctgaggaagccaagagccca
gacagctacttccacatggagacactggtgaagacgacgttcatcctcatcttcggtggc
acagagactgtgggcacaacactgcgccacagcttcctacttctcatgaagtatcctcag
attcaggcccgggtgcaggcggagattgacagcgtggtggggcgggggaggcggcccacg
ctggatgaccgctcctctatgccctacacggacgcagtcatccatgaggtgcagcgcttt
gcggacatcattcccatgaacttgccgcaccggcttacccgcgacacactctttcgaggc
ttcctgctacccaagggcactgatatcatcaccctcctcaacacggttcactatgacccc
agtcagttcaagacacctaatgagttcaaccctgcccacttcctggactccaaggaggaa
ttcaagaagagcccagccttcatgcccttctctgctggtcgacgtctgtgcttaggggaa
cccctggcccgcatggagctgttcctttacctgactgggattctgcagaacttcacacta
cagccactgtgctccccggaggagattgacttgactcccctcagctcgggcttgggcaat
gtgcctagacctttccagcttcgaatggtgccccgataa

DBGET integrated database retrieval system