KEGG   Monodelphis domestica (opossum): 100018814Help
Entry
100018814         CDS       T01031                                 

Gene name
DBH
Definition
(RefSeq) dopamine beta-hydroxylase
  KO
K00503  dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo00350  Tyrosine metabolism
mdo01100  Metabolic pathways
Module
mdo_M00042  Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    100018814 (DBH)
Enzymes [BR:mdo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     100018814 (DBH)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cu2_monoox_C Cu2_monooxygen DOMON NikR_C
Motif
Other DBs
NCBI-GeneID: 100018814
NCBI-ProteinID: XP_001371885
Ensembl: ENSMODG00000013013
UniProt: F7C7J2
Position
1
AA seq 632 aa AA seqDB search
MTIENQSLCTRVMQATGRYHKRTCCPSFKLREVVSMYCTMVAMFFIILLMALKGTVPREN
HFPYKIPLDPESILELSWNISYTEEVIYFQLLVKELKYGVILGMSDRGEFYNADLAVLWN
DGDNSYFGDAWSDAKGKIHLDSHQDYQLLQAQNTSAGLSLLLKRPFSTCDPRDYRIEDGT
IHLVYGFLDEPCLSLEAINTSAIQKGFQRVQLLKPNISIPEMPSDLIKMEIRAPNVTIPN
EETTYWCYMKKLPDDFSQHHIIKYEPIITKGNEALVHHMEVFQCAVEFEPYPEFSGPCDA
KMKSDRLNYCRHVLAAWALGAKAFYYPKEAGLPFGGPGSSKYLRLEVHYHNPLKIKDRID
NSGLRLHYTDKLRPFDAGIMELGLVYTPVMAIPPKETDFILTGYCTDKCTQLALPHSGIH
IFASQLHTHLTGRKVITVIVREGNVTEIVNRDDHYSPHFQEIRMLKKIVTVLPGDVLVTS
CTYNTESRELATVGGLSITKEMCVNYIHYYPLTQLELCKSYMDPGYLQIYFRFVNRFNNE
EIYTCHNTSVEEQFALVPWNSLSRTMLKALYNFAPISMHCNKSSAVRFPGEWERQLLPTI
KTRLEEVTPQCQDTPRLSPSASTLVNIDGKIG
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgaccattgagaaccagagtttgtgcaccagagtcatgcaagccactggcagataccac
aagagaacgtgctgtcccagcttcaaactccgagaggtggtatccatgtattgcaccatg
gtggccatgttcttcatcatcctcttgatggctctgaaaggcacagttccccgagaaaat
catttcccttacaagatccccctggaccctgagagcatcttggaattgtcctggaatatc
agctatacagaggaggtgatttatttccaacttctggtcaaggagctaaaatacggggtg
attttggggatgtctgatcggggtgagttctacaatgctgatctggccgtgctctggaat
gatggcgacaattcctattttggggatgcatggagtgatgcaaaagggaagatccatttg
gattcccatcaggattaccagcttttgcaagctcagaatacttctgcaggactctctctt
cttttgaagagacctttcagtacctgtgaccctagagattatcgcattgaggatggcacc
atacacttggtctatgggtttctggatgagccgtgcctctccctggaggccatcaacaca
tctgccattcagaaaggatttcaacgagtacaacttttgaagcctaacatctccatccct
gaaatgccttctgatctgatcaaaatggaaataagggctccaaatgtcacaattcccaat
gaagaaacaacatactggtgctacatgaaaaaactcccagatgactttagtcaacatcat
attatcaagtatgagcccatcattaccaagggcaatgaagccctagtccatcacatggag
gtcttccagtgcgctgtggagtttgagccatacccggagttcagcgggccctgtgatgca
aagatgaaatctgatcggctgaattactgcagacacgtgctggctgcctgggccttagga
gccaaggcattttactacccaaaagaagctggtcttccttttggaggcccaggatcttcc
aaatatctccgcctggaggttcattatcacaaccctctcaagataaaagatcggattgac
aactcgggtctccgcttgcattacacggacaaactgaggccatttgatgctgggatcatg
gagctgggcttagtatacacacctgtgatggccatcccacccaaagagactgacttcatc
ttgactggctattgcactgataaatgtactcaactggctctgccacattctggaatccac
atctttgcctcccagctccacactcacctcacagggaggaaagtgatcacggtcatagtc
cgagaaggaaatgtgacagagattgtgaatagggatgaccactacagccctcatttccag
gagatacgaatgttaaagaaaattgttactgttctcccgggcgatgtgctcgttacttct
tgtacatacaacacagaatccagagagctggcaactgtgggtggacttagcatcacaaaa
gaaatgtgtgtgaattatatacactactacccgctgacacagttggaattatgtaagagt
tatatggaccctggctatttacaaatatattttcgctttgttaacaggtttaacaatgag
gaaatctatacctgtcacaatacttctgtcgaagagcagtttgctttagtcccttggaat
tccttgagccggactatgctcaaggccctgtataactttgccccaatctccatgcattgc
aacaagtcttcagcagtccgctttccaggtgaatgggaaaggcagcttttaccaacaatc
aagactagactggaagaggttactccacaatgccaggacacgccaagactgtcaccttct
gcctctacactggtcaacattgatgggaaaataggctaa

DBGET integrated database retrieval system