KEGG   Monodelphis domestica (opossum): 100018858Help
Entry
100018858         CDS       T01031                                 

Definition
cytochrome P450 2A13-like
Orthology
K17685  
cytochrome P450, family 2, subfamily A, polypeptide 13 [EC:1.14.14.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Metabolism of xenobiotics by cytochrome P450
Chemical carcinogenesis
Class
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:mdo00980]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:mdo05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 495 aa AA seqDB search
MLVSGLLLGALFFCLSALVVLSVWRQRKVRGSLPPGPTPLPFIGNYLQLNTKQMYDSIMK
IGEKFGPVFTVHLGPRPIVVLSGYEAVKEALVDQAEEFSGRGEQATFDWLFKGFGVAFSN
GERARQLRRFSITTLRDFGMGKRGIEERIQEEAGFLVEALRGTKGAPIDPTFFLSRTVSN
VISSIVFGDRFEYEDKQFLSLLRMMLGSFQFTATSMGQLYEMFSGVMKHLPGPQQQAFKE
LQGLEDFITEKVRENQATLDPNHPRNFIDSFLIKMQEEKKNPNTEFFMRNLTMTTLNLFF
AGTETVSTTLRYGFLLLMKHPEVEAKIHEEIDRVIGRNRSPKFEDKAKMPYTEAVIHEIQ
RFGDMIPMGLARRVTKDTKFRGYLIPKGTEVYPMLGSVLRDQSFFACPQDFNPQHFLDEK
GQFKKSDAFVPFSIGKRYCFGEGLARMELFLFLTTILQNFRFQSPLPKEAIDISPKMVGF
ATIPRSYTISFLPRG
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgctggtctctgggctactactgggagccctgttcttttgcctctcagccctggtggta
ctctctgtctggagacagaggaaagtccgaggcagccttcctcctggacccaccccactg
cctttcattggcaactatctgcagctgaacactaagcagatgtatgactccattatgaag
attggggaaaaatttggacccgtgttcacagtacatctgggtcccaggcccatcgtggtt
ctgagtgggtatgaggctgtgaaggaggcactggtggaccaagcagaggagttctctggt
cgaggggagcaggccacctttgactggctctttaagggatttggtgtggccttcagcaat
ggagagagggcccggcagcttcgaagattctccataaccactctcagggactttggcatg
ggcaagaggggtatagaggagcgaatccaagaagaagctggcttccttgtggaggctctt
cgaggcacaaaaggggcccccattgatcccaccttcttcctgagccgcacagtttccaat
gtcatcagctccatcgtctttggagatcgatttgaatatgaggacaaacagttcctgtcc
ctgttgcgtatgatgttgggcagctttcagttcacagccacatccatgggacagttatat
gagatgttctctggagtgatgaagcacctgccagggcctcagcagcaagcattcaaggaa
ctgcaagggctggaagacttcatcactgagaaggtccgggagaaccaggccaccctggac
cccaaccacccccgcaacttcattgactccttccttatcaagatgcaggaggaaaagaaa
aatcccaacacagaattcttcatgaggaatttgaccatgaccactctaaacctgtttttt
gcgggcactgagactgttagcaccacccttcgctatggcttccttctgctaatgaaacat
ccagaggtggaagctaaaatccatgaggaaattgatcgtgtgattgggcggaacagatca
cccaagtttgaggacaaagccaagatgccatacacagaggctgtcatccatgagatccag
aggtttggggacatgatccccatgggtctggcccgaagagtcaccaaggacactaaattt
cgaggctatcttattcccaagggcacagaagtttatcccatgctgggctcagtgctgaga
gaccaaagcttctttgcctgcccccaagacttcaacccccaacacttcctggatgagaag
ggccagttcaaaaagagtgatgcgtttgtccccttctccattggaaaacgctactgtttt
ggtgaaggcttggccagaatggagctgttccttttcctcaccaccatccttcagaacttt
cgcttccagtcgccactcccaaaagaggccattgacatctccccaaagatggtgggtttt
gccactatcccccgcagctacactatctccttcctgccccgaggatga

DBGET integrated database retrieval system