KEGG   Monodelphis domestica (opossum): 100018927Help
Entry
100018927         CDS       T01031                                 

Definition
cytochrome P450 2B11-like
Orthology
K07412  
cytochrome P450, family 2, subfamily B [EC:1.14.14.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Steroid hormone biosynthesis
Arachidonic acid metabolism
Retinol metabolism
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    100018927
   00590 Arachidonic acid metabolism
    100018927
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100018927
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    100018927
Enzymes [BR:mdo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100018927
Cytochrome P450 [BR:mdo00199]
 Cytochrome P450, animal type
  CYP2 family
   100018927
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
4
AA seq 489 aa AA seqDB search
MNAGDLLLLLAVFLGFLLLLAKRPQKVNLPPGPTPLPLLGNLLQLGRHGLIKSFLECRDK
YGDVFTVYLGTRRYFVICGPESVKKALVDNAEVFSGRGTLAISEMVFQRYGFFVTYDGWK
TLRRVSIATLRDFGMGKRSIEEQIKAEAQCLVEELQKSQGALIDPTFIFHSVTANVICSI
VFGERFSYQDTQFREILNMFVEVFTILSSLWMQFFEQFPSVLKLLPGPHYRVLKIAQHIK
DFISSKIEQHQESLDPNSPRDFIDSFLLRIEKEKETPDSKYHVKNLVLTVLSLFFAGTET
TSTTLRYGFLLLLKYPQVAEKVQEEIDQVVGRDRAPEIKDRAKMPYTDAVIHEIQRFSDL
LPMGIPHMVTEDTSFQGYFLPKGTDVFILLSASLKDPCYFEKPHIFDPNHFLDAQGALKK
NEAFIPFSMGKRACLGEGIARTELFLFFTTILQNFSLVSSKPLEDLDIRPQCSGLGTLPQ
IYKLGFLPR
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atgaatgctggggacctcctcctcctcctagctgtctttttgggattcctcctgcttcta
gccaagagaccccagaaagtcaacctccctccagggcccacacctctgcctcttctaggc
aacctgctacaactgggccgccatggcctcatcaaatccttcttggagtgtcgagacaag
tatggagatgtgttcactgtctatctgggtacccggaggtattttgtgatatgtggacct
gagtctgtgaagaaggccctggtggataatgcagaggtgttcagtggccgtggaaccctt
gctatatctgaaatggtttttcaaagatatgggttttttgttacatatgatggatggaag
acacttcgaagagtctcaattgctaccctcagggactttgggatgggaaagaggagtatt
gaagaacaaataaaggcagaagcccaatgcctggtagaggaactccagaaatcccaaggg
gccctgatagaccccaccttcattttccattcagtcacagccaacgtcatttgttcgatt
gtatttggtgaacgcttctcttaccaagacacccagttccgggaaatattgaacatgttt
gttgaagttttcaccattttaagctccttatggatgcagttttttgaacagtttccaagt
gtgctaaagcttcttcctggcccccattaccgtgtattgaaaattgctcagcacatcaaa
gacttcatttctagcaagattgagcaacaccaagagagcctggaccccaattctccccgg
gacttcatagacagtttcctgcttcgcatagaaaaagagaaggagaccccagattccaag
taccatgttaagaaccttgtccttacagttctgagtttgttctttgcggggactgagaca
actagcaccactctgcgctatggcttccttctgcttcttaaatacccccaggtggcagag
aaagtccaggaggagattgaccaggtggttggacgggaccgtgccccggagatcaaggat
cgagccaaaatgccctacacagatgctgtcatccatgagatccagagatttagtgaccta
cttcctatgggtatccctcacatggtgactgaggacacttccttccagggctactttctt
cctaagggtaccgatgtgttcattttgctgagcgccagtctgaaagatccttgttatttt
gagaagccgcacatctttgaccccaaccacttcttggatgcccaaggagctctgaaaaag
aatgaagcctttatccccttctccatggggaagcgagcctgtctaggtgagggtattgcc
cgaacagaactcttcctcttcttcaccaccatcctgcagaacttctccctggtctcctcc
aagccccttgaagatttggacatcaggccccagtgcagtgggctcgggacgctgccccaa
atctacaagctcggcttcttgccccgatga

DBGET integrated database retrieval system