KEGG   Monodelphis domestica (opossum): 100018936Help
Entry
100018936         CDS       T01031                                 

Gene name
HDAC6
Definition
histone deacetylase 6
Orthology
K11407  
histone deacetylase 6 [EC:3.5.1.98]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Alcoholism
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    100018936 (HDAC6)
  Substance dependence
   05034 Alcoholism
    100018936 (HDAC6)
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100018936 (HDAC6)
Protein phosphatases and associated proteins [BR:mdo01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100018936 (HDAC6)
Messenger RNA biogenesis [BR:mdo03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     100018936 (HDAC6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
X
AA seq 1069 aa AA seqDB search
MASPVEKPGPSHRSSSPTRPPSASSSRMMGQKRGVRKGSPIPRASPSLADVRRRGRAKKL
SQVSELDLVTDLQDLDLEAGAAVPSGTGLVLDERMSSFHCPWDESFPERPERLQAVQEQL
ARDCLLERCLLIEAQPATPEELQLVHSQEYVDLMASTPQMTESERRALSDTYDSVYLHPN
SFPCALLATGALLRLVDALMTGEIRNGLAVVRPPGHHAQRESMNGYCMFNNIAIAARYAQ
ERHHVARILIVDWDVHHGQGTQFIFEQDPSVLCFSVHRYELGRFWPHLEASDWRATGHGK
GQGYTVNVPWNQVGMRDGDYITAFLHVLLPIALEFQPQMVLVAAGFDAMLGDPKGEMAAT
PGGFAHLTHLLMGLAKGRLILSLEGGYNLHSLALGVSATLQTLLGDPCPMLATPCAPCPS
ALASLSSTLAAHRPFWKVIQRFQSTSEDKEDEYRGVSLGPPPILESLGKSLEQALSLPPS
RTGLVYDEKMMEHFNMWDSHHPERPERIAQIAQHHMELGLTPRCFVLPARSATNQELLAC
HSEEYIERIRATSGLKPRDLHREGTSYNSIYISPHSFCCAQLAAGAACRLVEAILAREVQ
NGLAIVRPPGHHAERDAACGFCFFNSVAVAARHAQEVAGRALRILIVDWDIHHGNGTQHI
FEEDPSVLYVSLHRYDHGAFFPMAEDGASSHVGRGQGEGFNVNVAWNGPRLGDPDYLTAM
HHIVMPIAYEFNPELVLVSAGFDAARGDPLGGCLVSPEGYAHMTHLLMGLAGGRIALVLE
GGYNLTSISESMAACTRTLLGDPPPLMPWLRPPLPGTFLSLAEVAHIHQKYWQSLRLNAV
ETEAEVEEKEIPPEPAKESTPGQKLPDQRPSKALAIGPELEKQPLSPGLDETLGLESLQL
STCAPEELEAEPSIAKEKHPEDPGLLGEAAGGGGQAAATLLNVLGDQSEDEGATFYAVTP
LPWCPHLVTVRPVPEGGLDVTQPCQGCDTHVENWLCLSCYQVHCGRYVGAHMLQHHEASG
HPLVLSYADLSAWCYICQAYVNHEVLLEAKKTAYQAKFGEEMPTFPRQD
NT seq 3210 nt NT seq  +upstreamnt  +downstreamnt
atggcatccccagtggagaagccaggcccgagtcatcgaagcagtagcccaacccgccca
ccatctgcgtccagcagcagaatgatggggcaaaagcgaggagtccggaaaggatcgccc
atccctcgggccagcccaagtttagctgatgtccgacgaagagggagggcaaagaaattg
agtcaagtgtcagagctagatctggtgactgacctgcaggacctggaccttgaggcaggg
gcagcagtaccttcagggactggtctggtgctggatgagagaatgagcagtttccactgc
ccctgggatgagagtttcccagaaaggccagaacgccttcaggccgtgcaggaacaacta
gccagggactgtctgctggagcggtgcttgctcattgaggcccagccagccactcctgag
gaactgcagctggtccatagtcaagaatatgtggacttgatggcatccacaccccagatg
actgaaagcgaacgtcgggccctctcagacacctatgattctgtctacctgcatccgaac
tcattcccttgtgccctcctggctactggggcgctgcttcggctggtggatgctctgatg
acaggcgagatccgaaatgggctagctgttgtcaggccccctggacaccatgcccagcga
gagagcatgaacggctactgcatgttcaacaacattgccatagctgcccgctatgcccaa
gaaaggcaccatgtagcacggatactcattgtggattgggatgttcaccacggtcaaggc
acccagttcatctttgagcaggaccccagtgtcctttgcttctccgttcaccgctatgag
ctgggccgattctggccccatctagaagcatctgactggcgggcaacaggccacggcaag
ggtcagggatacactgtcaacgtgccttggaaccaggtggggatgagggatggggattac
atcaccgccttcctccatgtgctgctccccattgctctggagtttcagcctcagatggtt
ctggtggccgctggcttcgatgccatgctgggtgaccccaagggagagatggcagccact
ccagggggctttgctcacctcactcacttgctcatgggtctggccaaggggaggctgatt
ctgtctctggagggtggctacaatctgcactcccttgctctgggggtcagtgccactctc
cagaccctcctgggagacccatgtcccatgctggcaacaccgtgcgccccctgccccagt
gccctggcttccttgtcctctaccctggctgctcacagacctttctggaaggtcatacag
aggtttcagtctacctctgaggacaaggaggacgagtacaggggagtgagcctgggccct
cccccaattctcgagtccctggggaaatctttagagcaggccctgtctctgcctccaagc
cgaacaggcttggtgtatgatgagaagatgatggagcatttcaacatgtgggacagccac
cacccagagcggcccgagcgcattgcccaaatcgcccagcaccacatggagctggggctg
acccctcgatgtttcgtgttgcctgcccgctctgctacaaaccaggagctgctggcttgc
cacagtgaggagtacattgagcgtattcgggccacgagcgggctgaaacctcgggaccta
caccgtgagggcaccagttacaactccatctatatctccccccactccttctgctgcgcc
cagcttgctgccggagctgcctgccgtttggtggaggccatcttggctagggaggtgcag
aatgggctggccattgtccgcccaccaggccaccatgctgaaagagatgctgcctgcggt
ttctgcttcttcaactctgtggcggtggctgctcggcacgctcaggaggtggcaggccgg
gccctcagaatcctgattgtggactgggacattcaccatggcaatggaacccagcacata
tttgaagaggaccccagtgtgctgtacgtgtccctgcaccgctatgatcatggtgccttc
ttccccatggctgaggacggtgctagcagccatgtgggccgaggccagggagagggcttc
aatgtcaatgtggcatggaatgggccccgccttggagatcctgactatctcaccgccatg
caccatattgtgatgcccatcgcctacgagttcaaccctgagctggtgctggtatctgct
ggctttgatgctgctcggggggacccactagggggctgcctggtttccccagagggctat
gcccatatgactcacctgctgatgggactggctggtggccgcattgccctggtccttgag
ggtggctacaacctgacctccatctcagaatccatggctgcttgcacccggacccttcta
ggtgacccacccccactgatgccctggcttcggcctccgctgcctggaaccttcctctca
ctggctgaggttgcccacatccaccagaagtattggcaaagcttgcggcttaatgcagta
gagacagaagcggaggtggaagaaaaggagataccaccagagccagcaaaggagagtacc
ccggggcagaagcttcctgaccagaggccctcaaaggctttggccataggaccagagcta
gagaaacagcccctgtcacctgggcttgacgagaccttgggcctggagtcccttcaactc
agcacgtgtgctccagaggagctggaggctgagccctccattgccaaagaaaagcacccc
gaggatcctggcctcctcggggaggcagctggtggagggggccaggctgctgccacattg
ctgaatgtcctaggggaccaatctgaggatgagggggccacattctatgctgtgaccccg
ctaccctggtgcccacacctggtgactgtgcgcccagtgcctgaggggggcctggatgtg
acccagccatgccagggctgtgacacccatgtggagaactggctctgcctgtcttgctat
caggttcattgtggccgctatgtgggagctcacatgctgcagcatcatgaggcctcgggc
caccccctggtcctaagctatgctgacctctcagcctggtgttacatctgccaggcctac
gtgaaccatgaggttctgctggaggccaagaaaacagcgtaccaggccaagtttggggag
gagatgccaacgttcccgagacaggactga

DBGET integrated database retrieval system