KEGG   Monodelphis domestica (opossum): 100018936Help
Entry
100018936         CDS       T01031                                 

Definition
histone deacetylase 6-like
Orthology
K11407  
histone deacetylase 6/10 [EC:3.5.1.98]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Alcoholism
Viral carcinogenesis
Class
Human Diseases; Cancers; Viral carcinogenesis [PATH:mdo05203]
Human Diseases; Substance dependence; Alcoholism [PATH:mdo05034]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
X
AA seq 1117 aa AA seqDB search
MGVMSQKSQSSVAGGEGEEDPDGGGGSGKARECVNCGATATPLWRRDGTGHYLCNACGLY
HKMNGQNRPLIRPKKRLGQKRGVRKGSPIPRASPSLADVRRRGRAKKLSQVSELDLVTDL
QDLDLEAGAAVPSGTGLVLDERMSSFHCPWDESFPERPERLQAVQEQLARDCLLERCLLI
EAQPATPEELQLVHSQEYVDLMASTPQMTESERRALSDTYDSVYLHPNSFPCALLATGAL
LRLVDALMTGEIRNGLAVVRPPGHHAQRESMNGYCMFNNIAIAARYAQERHHVARILIVD
WDVHHGQGTQFIFEQDPSVLCFSVHRYELGRFWPHLEASDWRATGHGKGQGYTVNVPWNQ
VGMRDGDYITAFLHVLLPIALEFQPQMVLVAAGFDAMLGDPKGEMAATPGGFAHLTHLLM
GLAKGRLILSLEGGYNLHSLALGVSATLQTLLGDPCPMLATPCAPCPSALASLSSTLAAH
RPFWKVIQRFQSTSEDKEDEYRGVSLGPPPILESLGKSLEQALSLPPSRTGLVYDEKMME
HFNMWDSHHPERPERIAQIAQHHMELGLTPRCFVLPARSATNQELLACHSEEYIERIRAT
SGLKPRDLHREGTSYNSIYISPHSFCCAQLAAGAACRLVEAILAREVQNGLAIVRPPGHH
AERDAACGFCFFNSVAVAARHAQEVAGRALRILIVDWDIHHGNGTQHIFEEDPSVLYVSL
HRYDHGAFFPMAEDGASSHVGRGQGEGFNVNVAWNGPRLGDPDYLTAMHHIVMPIAYEFN
PELVLVSAGFDAARGDPLGGCLVSPEGYAHMTHLLMGLAGGRIALVLEGGYNLTSISESM
AACTRTLLGDPPPLMPWLRPPLPGTFLSLAEVAHIHQKYWQSLRLNAVETEAEVEEKEIP
PEPAKESTPGQKLPDQRPSKALAIGPELEKQPLSPGLDETLGLESLQLSTCAPEELEAEP
SIAKEKHPEDPGLLGEAAGGGGQAAATLLNVLGDQSEDEGATFYAVTPLPWCPHLVTVRP
VPEGGLDVTQPCQGCDTHVENWLCLSCYQVHCGRYVGAHMLQHHEASGHPLVLSYADLSA
WCYICQAYVNHEVLLEAKKTAYQAKFGEEMPTFPRQD
NT seq 3354 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtgatgtcacaaaagtctcaaagtagtgtggctggtggggaaggggaagaagac
cctgatggcggtggcggcagtggcaaggccagagaatgtgtgaactgtggagcaactgct
accccgctgtggcgtcgagatggcactgggcactacctatgcaatgcttgtggcctttac
cacaagatgaatgggcagaatcggcccctcatcagacccaagaagcgcttggggcaaaag
cgaggagtccggaaaggatcgcccatccctcgggccagcccaagtttagctgatgtccga
cgaagagggagggcaaagaaattgagtcaagtgtcagagctagatctggtgactgacctg
caggacctggaccttgaggcaggggcagcagtaccttcagggactggtctggtgctggat
gagagaatgagcagtttccactgcccctgggatgagagtttcccagaaaggccagaacgc
cttcaggccgtgcaggaacaactagccagggactgtctgctggagcggtgcttgctcatt
gaggcccagccagccactcctgaggaactgcagctggtccatagtcaagaatatgtggac
ttgatggcatccacaccccagatgactgaaagcgaacgtcgggccctctcagacacctat
gattctgtctacctgcatccgaactcattcccttgtgccctcctggctactggggcgctg
cttcggctggtggatgctctgatgacaggcgagatccgaaatgggctagctgttgtcagg
ccccctggacaccatgcccagcgagagagcatgaacggctactgcatgttcaacaacatt
gccatagctgcccgctatgcccaagaaaggcaccatgtagcacggatactcattgtggat
tgggatgttcaccacggtcaaggcacccagttcatctttgagcaggaccccagtgtcctt
tgcttctccgttcaccgctatgagctgggccgattctggccccatctagaagcatctgac
tggcgggcaacaggccacggcaagggtcagggatacactgtcaacgtgccttggaaccag
gtggggatgagggatggggattacatcaccgccttcctccatgtgctgctccccattgct
ctggagtttcagcctcagatggttctggtggccgctggcttcgatgccatgctgggtgac
cccaagggagagatggcagccactccagggggctttgctcacctcactcacttgctcatg
ggtctggccaaggggaggctgattctgtctctggagggtggctacaatctgcactccctt
gctctgggggtcagtgccactctccagaccctcctgggagacccatgtcccatgctggca
acaccgtgcgccccctgccccagtgccctggcttccttgtcctctaccctggctgctcac
agacctttctggaaggtcatacagaggtttcagtctacctctgaggacaaggaggacgag
tacaggggagtgagcctgggccctcccccaattctcgagtccctggggaaatctttagag
caggccctgtctctgcctccaagccgaacaggcttggtgtatgatgagaagatgatggag
catttcaacatgtgggacagccaccacccagagcggcccgagcgcattgcccaaatcgcc
cagcaccacatggagctggggctgacccctcgatgtttcgtgttgcctgcccgctctgct
acaaaccaggagctgctggcttgccacagtgaggagtacattgagcgtattcgggccacg
agcgggctgaaacctcgggacctacaccgtgagggcaccagttacaactccatctatatc
tccccccactccttctgctgcgcccagcttgctgccggagctgcctgccgtttggtggag
gccatcttggctagggaggtgcagaatgggctggccattgtccgcccaccaggccaccat
gctgaaagagatgctgcctgcggtttctgcttcttcaactctgtggcggtggctgctcgg
cacgctcaggaggtggcaggccgggccctcagaatcctgattgtggactgggacattcac
catggcaatggaacccagcacatatttgaagaggaccccagtgtgctgtacgtgtccctg
caccgctatgatcatggtgccttcttccccatggctgaggacggtgctagcagccatgtg
ggccgaggccagggagagggcttcaatgtcaatgtggcatggaatgggccccgccttgga
gatcctgactatctcaccgccatgcaccatattgtgatgcccatcgcctacgagttcaac
cctgagctggtgctggtatctgctggctttgatgctgctcggggggacccactagggggc
tgcctggtttccccagagggctatgcccatatgactcacctgctgatgggactggctggt
ggccgcattgccctggtccttgagggtggctacaacctgacctccatctcagaatccatg
gctgcttgcacccggacccttctaggtgacccacccccactgatgccctggcttcggcct
ccgctgcctggaaccttcctctcactggctgaggttgcccacatccaccagaagtattgg
caaagcttgcggcttaatgcagtagagacagaagcggaggtggaagaaaaggagatacca
ccagagccagcaaaggagagtaccccggggcagaagcttcctgaccagaggccctcaaag
gctttggccataggaccagagctagagaaacagcccctgtcacctgggcttgacgagacc
ttgggcctggagtcccttcaactcagcacgtgtgctccagaggagctggaggctgagccc
tccattgccaaagaaaagcaccccgaggatcctggcctcctcggggaggcagctggtgga
gggggccaggctgctgccacattgctgaatgtcctaggggaccaatctgaggatgagggg
gccacattctatgctgtgaccccgctaccctggtgcccacacctggtgactgtgcgccca
gtgcctgaggggggcctggatgtgacccagccatgccagggctgtgacacccatgtggag
aactggctctgcctgtcttgctatcaggttcattgtggccgctatgtgggagctcacatg
ctgcagcatcatgaggcctcgggccaccccctggtcctaagctatgctgacctctcagcc
tggtgttacatctgccaggcctacgtgaaccatgaggttctgctggaggccaagaaaaca
gcgtaccaggccaagtttggggaggagatgccaacgttcccgagacaggactga

DBGET integrated database retrieval system