KEGG   Monodelphis domestica (opossum): 100018994Help
Entry
100018994         CDS       T01031                                 

Definition
cytochrome P450 2S1-like
Orthology
K07420  
cytochrome P450, family 2, subfamily S, polypeptide 1 [EC:1.14.14.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Class
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:mdo00830]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:mdo00980]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 672 aa AA seqDB search
MSMYLYDMDSTFIMIVLPWVELWRRVLRGHGTAEPAKGSKRLLVLVGKLRPGVPLRVSGR
AGAELGALGAGDGGGGGGGSVRGGVKLGGWPGRQVLEPAGCAESAWRPQGRRRRAPDFEP
STRFGPGSGRGLIPVASRGGAPQGRLYKRRGPSPRPPCCGLGMALATGVASPLLVLVLVL
VLLLALLVLRQGRPRSSRLPPGPPPLPLLGNVGQLRLSPLFNPSDCFSLQLSAKYGPVFT
VYLGSRPVVVLSGYRAVKEALVDQAEAFSGRGKIAGLEKTFHEHGLFFANGEQWRSLRKF
TTLSLRALGMGKKEGEEHIQEEARCLLEALRSTQGSPLDPSLLLSQAVSNITCLLLFGKR
FDYEDKKFQAMVLATAGILTEISSPWGQVCEMFMGPVCYLSDILKYLSAPHGRLTRHLST
LAAFVSDQIQQHQETLDPEAPVRDFIDDFLLKMRQEEKAQGVGPDHTDFLLTTVNLLFAG
TVTVSATLRFAFLLLLKYPEFQDRIHEELNQELGRERAPSLGDRGRLPYTDAFLHEVQRF
LALIPMGVPRTVTKPTIFQGYELPQGIEVFPLLGSVLHDPEFFERPKEFYPRHFLNADGR
FIKNEAFLPFSSGKRICLGEGLARTELFLFFTTILQNFSLESPSPLGALSLHPAISGFAN
IPPTFQLRFRPR
NT seq 2019 nt NT seq  +upstreamnt  +downstreamnt
atgtccatgtacctctatgacatggactcaaccttcatcatgattgtactcccctgggtg
gagctgtggcggagggtgctccgaggtcacggaactgccgaacctgcaaaggggagtaaa
cgcctccttgtgctcgtggggaaactgaggcccggagtcccactgagagttagcggcaga
gccggggcggagttgggtgctttaggagcaggtgacggcggcggcggcggcggcggcagc
gtccgggggggcgtgaaattgggcggctggccggggcggcaggtactggagcctgcaggc
tgcgctgagtcagcctggcgaccccaggggcgccggcggcgggctccggacttcgagccc
tccactcggtttggcccagggtcggggaggggcctaatcccggtggcctcccgaggcggg
gccccgcagggccggctttataagcggcgcggcccctctccccgccctccctgctgcggg
ctcgggatggcgctggccacgggagtcgcctctccgctcctggtcctggtcctggtcctg
gtcctcctcctggcgctgctcgtcctccgccaaggccgcccccgctcctcccgcctgccc
cccgggccgccaccgctgccgctgctggggaatgtgggccagctccggctaagcccgctc
tttaaccccagcgactgcttctccctgcagctcagtgccaagtatggccctgtgttcacc
gtgtacctgggctcccggcctgtggtggtcctgagtggttaccgggcggtcaaggaggct
ctggtggaccaggccgaggcgttctccggccgggggaagattgctgggctggagaagacc
ttccatgagcacggcctcttctttgccaatggggagcagtggagatcccttcggaagttc
accacgctctctctgagagccctgggcatgggcaagaaggaaggcgaagagcacattcag
gaggaggcccgctgcctgctggaagccttacggagtacccaagggtcccccctggacccg
tccctgctcctgtctcaggctgtctccaacatcacctgccttctcctgtttggaaagcgc
tttgactatgaagacaagaagttccaagccatggtccttgccactgccggcatcctgacg
gagataagctccccctggggacaggtctgcgagatgttcatgggccccgtctgctacttg
tcagacatccttaaatatctctcggctccccatggccggctcaccagacacctgagcacc
ctggcagccttcgtctcagaccaaatccagcagcaccaggagacgctggaccctgaggcc
cccgtcagggactttattgatgatttcctgctcaagatgcgccaggaagaaaaggcccaa
ggagtagggcctgaccacacagatttcctgctgaccaccgtgaacttgttgtttgcgggg
acagtaacagtctctgctacactgagattcgccttcctgctcctgctcaaatacccagag
ttccaagatcgcatccatgaggaactaaaccaagagcttgggcgggagagggcccctagc
ctaggagaccgggggcgtctgccctacaccgatgccttcctgcatgaggttcagaggttc
ttggccctcatccctatgggagtaccccgtaccgtcaccaaacccaccatcttccagggc
tatgaattgccccagggtattgaagtcttccccctcctgggatctgttctccacgaccca
gaattctttgagcgtccaaaagaattctacccaagacacttcctgaatgctgatggccga
ttcatcaaaaacgaggccttcttgcctttctcctcagggaaacgaatctgccttggagag
ggcctggcccgcaccgagctcttcctcttcttcaccacaatcctccagaatttctccctg
gagagtccatccccccttggggctctgagcctccatccagccatcagtggtttcgccaac
attcctcccaccttccaactccgtttccggccccgctga

DBGET integrated database retrieval system