KEGG   Monodelphis domestica (opossum): 100018994Help
Entry
100018994         CDS       T01031                                 

Definition
cytochrome P450 2S1-like
Orthology
K07420  
cytochrome P450, family 2, subfamily S, polypeptide 1 [EC:1.14.14.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Retinol metabolism
Metabolism of xenobiotics by cytochrome P450
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100018994
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100018994
Enzymes [BR:mdo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100018994
Cytochrome P450 [BR:mdo00199]
 Cytochrome P450, animal type
  CYP2 family
   100018994
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 510 aa AA seqDB search
MALATGVASPLLVLVLVLVLLLALLVLRQGRPRSSRLPPGPPPLPLLGNVGQLRLSPLFN
PSDCFSLQLSAKYGPVFTVYLGSRPVVVLSGYRAVKEALVDQAEAFSGRGKIAGLEKTFH
EHGLFFANGEQWRSLRKFTTLSLRALGMGKKEGEEHIQEEARCLLEALRSTQGSPLDPSL
LLSQAVSNITCLLLFGKRFDYEDKKFQAMVLATAGILTEISSPWGQVCEMFMGPVCYLSD
ILKYLSAPHGRLTRHLSTLAAFVSDQIQQHQETLDPEAPVRDFIDDFLLKMRQEEKAQGV
GPDHTDFLLTTVNLLFAGTVTVSATLRFAFLLLLKYPEFQDRIHEELNQELGRERAPSLG
DRGRLPYTDAFLHEVQRFLALIPMGVPRTVTKPTIFQGYELPQGIEVFPLLGSVLHDPEF
FERPKEFYPRHFLNADGRFIKNEAFLPFSSGKRICLGEGLARTELFLFFTTILQNFSLES
PSPLGALSLHPAISGFANIPPTFQLRFRPR
NT seq 1533 nt NT seq  +upstreamnt  +downstreamnt
atggcgctggccacgggagtcgcctctccgctcctggtcctggtcctggtcctggtcctc
ctcctggcgctgctcgtcctccgccaaggccgcccccgctcctcccgcctgccccccggg
ccgccaccgctgccgctgctggggaatgtgggccagctccggctaagcccgctctttaac
cccagcgactgcttctccctgcagctcagtgccaagtatggccctgtgttcaccgtgtac
ctgggctcccggcctgtggtggtcctgagtggttaccgggcggtcaaggaggctctggtg
gaccaggccgaggcgttctccggccgggggaagattgctgggctggagaagaccttccat
gagcacggcctcttctttgccaatggggagcagtggagatcccttcggaagttcaccacg
ctctctctgagagccctgggcatgggcaagaaggaaggcgaagagcacattcaggaggag
gcccgctgcctgctggaagccttacggagtacccaagggtcccccctggacccgtccctg
ctcctgtctcaggctgtctccaacatcacctgccttctcctgtttggaaagcgctttgac
tatgaagacaagaagttccaagccatggtccttgccactgccggcatcctgacggagata
agctccccctggggacaggtctgcgagatgttcatgggccccgtctgctacttgtcagac
atccttaaatatctctcggctccccatggccggctcaccagacacctgagcaccctggca
gccttcgtctcagaccaaatccagcagcaccaggagacgctggaccctgaggcccccgtc
agggactttattgatgatttcctgctcaagatgcgccaggaagaaaaggcccaaggagta
gggcctgaccacacagatttcctgctgaccaccgtgaacttgttgtttgcggggacagta
acagtctctgctacactgagattcgccttcctgctcctgctcaaatacccagagttccaa
gatcgcatccatgaggaactaaaccaagagcttgggcgggagagggcccctagcctagga
gaccgggggcgtctgccctacaccgatgccttcctgcatgaggttcagaggttcttggcc
ctcatccctatgggagtaccccgtaccgtcaccaaacccaccatcttccagggctatgaa
ttgccccagggtattgaagtcttccccctcctgggatctgttctccacgacccagaattc
tttgagcgtccaaaagaattctacccaagacacttcctgaatgctgatggccgattcatc
aaaaacgaggccttcttgcctttctcctcagggaaacgaatctgccttggagagggcctg
gcccgcaccgagctcttcctcttcttcaccacaatcctccagaatttctccctggagagt
ccatccccccttggggctctgagcctccatccagccatcagtggtttcgccaacattcct
cccaccttccaactccgtttccggccccgctga

DBGET integrated database retrieval system