KEGG   Monodelphis domestica (opossum): 100019066Help
Entry
100019066         CDS       T01031                                 

Gene name
PRKAA2
Definition
(RefSeq) protein kinase AMP-activated catalytic subunit alpha 2
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo04068  FoxO signaling pathway
mdo04140  Autophagy - animal
mdo04150  mTOR signaling pathway
mdo04151  PI3K-Akt signaling pathway
mdo04152  AMPK signaling pathway
mdo04211  Longevity regulating pathway
mdo04213  Longevity regulating pathway - multiple species
mdo04371  Apelin signaling pathway
mdo04530  Tight junction
mdo04710  Circadian rhythm
mdo04714  Thermogenesis
mdo04910  Insulin signaling pathway
mdo04920  Adipocytokine signaling pathway
mdo04921  Oxytocin signaling pathway
mdo04922  Glucagon signaling pathway
mdo04931  Insulin resistance
mdo04932  Non-alcoholic fatty liver disease (NAFLD)
mdo05410  Hypertrophic cardiomyopathy (HCM)
mdo05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    100019066 (PRKAA2)
   04068 FoxO signaling pathway
    100019066 (PRKAA2)
   04151 PI3K-Akt signaling pathway
    100019066 (PRKAA2)
   04152 AMPK signaling pathway
    100019066 (PRKAA2)
   04150 mTOR signaling pathway
    100019066 (PRKAA2)
 Cellular Processes
  Transport and catabolism
   04140 Autophagy - animal
    100019066 (PRKAA2)
  Cellular community - eukaryotes
   04530 Tight junction
    100019066 (PRKAA2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100019066 (PRKAA2)
   04922 Glucagon signaling pathway
    100019066 (PRKAA2)
   04920 Adipocytokine signaling pathway
    100019066 (PRKAA2)
   04921 Oxytocin signaling pathway
    100019066 (PRKAA2)
  Aging
   04211 Longevity regulating pathway - mammal
    100019066 (PRKAA2)
   04213 Longevity regulating pathway - multiple species
    100019066 (PRKAA2)
  Environmental adaptation
   04710 Circadian rhythm
    100019066 (PRKAA2)
   04714 Thermogenesis
    100019066 (PRKAA2)
 Human Diseases
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    100019066 (PRKAA2)
   05410 Hypertrophic cardiomyopathy (HCM)
    100019066 (PRKAA2)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100019066 (PRKAA2)
   04931 Insulin resistance
    100019066 (PRKAA2)
Enzymes [BR:mdo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     100019066 (PRKAA2)
Protein kinases [BR:mdo01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   100019066 (PRKAA2)
Membrane trafficking [BR:mdo04131]
 Autophagy
  Other autophagy associated proteins
   Others
    100019066 (PRKAA2)
Mitochondrial biogenesis [BR:mdo03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    100019066 (PRKAA2)
  Mitophagy factors
   Other mitophagy factors
    100019066 (PRKAA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr AdenylateSensor Kinase-like RIO1 Kdo Haspin_kinase APH
Motif
Other DBs
NCBI-GeneID: 100019066
NCBI-ProteinID: XP_001365251
Position
2
AA seq 551 aa AA seqDB search
MAEKPKHDGRVKIGHYVLGDTLGVGTFGKVKIGEHQLTGHKVAVKILNRQKIRSLDVVGK
IKREIQNLKLFRHPHIIKLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEEIEARRLF
QQILSAVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYA
APEVISGRLYAGPEVDIWSCGVILYALLCGTLPFDDEHVPTLFKKIRGGVFYIPEYLNRS
VATLLMHMLQVDPLKRATIKDIREHEWFKQDLPSYLFPEDPSYDANVIDDEAVKEVCEKF
ECTESEVMNSLYSGDPQDQLAVAYHLIIDNRRIMNQASEFYLASSPPTGSFMDDSTMHIP
IGLKPHPERMPPLISDSPKAKCPLDALNTTKPKSLAVKKAKWHLGIRSQSKPCDIMSEVY
RAMRQLGYEWKVVNAYYLRVRRKNPVTGNYVKMSLQLYQVDNRSYLLDFKSIDDDVTEQK
SGSSTPQRSCSAAGLHRPRLSFDSTTADCHSLTGSLTGSLTGSVPSVTPRLGSHTMDFFE
MCASLITTLAR
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atggcggagaagccgaagcacgacgggcgcgtgaagatcggccactacgtgctgggcgac
acgctgggggtcggcaccttcggcaaagtgaagattggagaacaccagttgacgggtcat
aaagtagcagtaaaaatcttaaatagacagaagattcgtagtttggatgtggttggaaaa
atcaaaagagagattcaaaatctgaaactcttccgacatccgcacattatcaaactatac
caagtcatcagcaccccaactgacttttttatggtaatggaatacgtatctggtggtgaa
ttatttgactacatctgtaaacatggacgggtcgaagagatagaggccaggaggctcttt
cagcagattctttctgctgtggattattgtcacagacatatggttgttcacagagacctg
aaacccgagaatgtgctgctagatgcccacatgaatgccaagattgctgactttggttta
tcaaatatgatgtcagatggtgaatttctgagaacaagctgtgggtctccaaattatgca
gcacccgaagtcatctcaggcaggttgtacgcggggcccgaggtggacatctggagctgc
ggagtgatcctgtacgccctcctctgcggcacgctgcccttcgacgacgagcacgtcccg
accttattcaagaaaatccgcggaggagttttttacatcccggagtatctgaaccgttct
gtggctactctcctcatgcacatgttgcaggtggaccccctgaaacgagcaaccatcaaa
gacataagagagcacgagtggtttaaacaagatctgcccagttatttatttcctgaagac
ccttcctatgatgcaaatgtcattgatgatgaagccgtgaaggaagtgtgtgaaaagttt
gagtgcacagagtctgaagtgatgaacagcttgtacagtggggaccctcaagaccagctc
gcagtggcttatcacctcatcattgataaccggagaatcatgaaccaggccagcgagttc
tacctggcctctagcccgcccaccggctccttcatggatgacagcaccatgcacatcccc
attgggctgaagccacaccctgagcggatgccgcctctaatatccgacagtcccaaggcc
aagtgtcccttggatgctctgaataccaccaagcccaaatcgctagctgtgaaaaaggcc
aagtggcatctggggattcgtagccaaagcaaaccctgtgacatcatgagtgaagtctac
cgggccatgagacagctaggctatgagtggaaggtggtgaatgcatactatcttagagta
agaagaaagaaccctgtcactggcaattatgtgaaaatgagcctccagctttaccaggtg
gacaatcgcagttacctcttggacttcaaaagtattgatgatgatgtcacagagcagaag
tctggttcttcgacgcctcaacgttcatgctctgctgctggcttacatagaccaaggctg
agttttgattccaccacagctgactgtcattctctcactggatccctgactggctccttg
acagggagtgtgccttctgtaactccacgcctcggcagccacaccatggatttttttgaa
atgtgcgccagtctcatcactacgttagcgcgttga

DBGET integrated database retrieval system