KEGG   Monodelphis domestica (opossum): 100019113Help
Entry
100019113         CDS       T01031                                 

Gene name
PDIA5
Definition
protein disulfide isomerase family A, member 5
Orthology
K09583  
protein disulfide isomerase family A, member 5 [EC:5.3.4.1]
Organism
mdo  Monodelphis domestica (opossum)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 534 aa AA seqDB search
MNYNKFFTENLLKKKVLVPSVFVLLSFKVVLPVCLSSNQISPLIKKISEHKDFKKLLRTR
NNILVLYSKSAAAAENHLRLLSNVAKTVKGQGTISWVDCGDAESRKLCKKMKVDPSTKDK
RVELFHYKDGVFHTEYNRAVTFKSIVAFLKDPEGAPLWEEDPEAKDVVHVDSEKEFRRIV
KKDDKPLLMMFYAPWCAMCKRMMPSFQQAATELKGTHVLAGMNVYSSEFEHIKEEYDVRG
YPTICYFEKGKFLFQYENYRSTAKDIVEWMKNPHPPQPQVPEAAWADEGSVVYHLTDEDF
DKFMKEHSSVLIMFHAPWCGHCKKMKPEFESAAEALHGVADSPGVLAAVDATVNKAIAER
YQISGFPTLKYFKDGEEKYTLPQLRTKKKIIEWMKNPEAPPPPEPAWEEKQTSVLHLTGV
DFREALKKKKHALVMFYAPWCPHCKSTIPNFTATAELFKDDRKIACAAVDCAKDKNRDLC
KQEGVDGYPTFNYYNYGKMIEKYNGDRTESGFVSFVRTLRERDHERLGKKKDEL
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgaattacaacaaattcttcacagagaatttgctgaaaaagaaagtgcttgttccttct
gtttttgtgcttttaagtttcaaggtagtcctgcccgtgtgtttgtcctctaaccagatt
tccccactcatcaagaaaatctcggaacataaggatttcaagaagcttctcaggactcgg
aataatatattggtgctttactccaaatctgctgctgcagctgaaaaccacctcaggtta
ttgtccaatgtggccaagacggtgaaaggtcaaggcaccatctcctgggtagactgtggt
gatgcagagagtcggaaattgtgcaagaaaatgaaagttgacccaagcacaaaagacaaa
agagtggaattatttcactacaaggatggtgtgtttcacactgaatataatcgtgctgtg
acatttaagtccatcgtggcctttctgaaggatcctgaaggggctccactttgggaagaa
gatcctgaagcaaaagatgttgtccatgttgacagtgaaaaggaattcagacggattgtg
aagaaggatgacaaacctcttctgatgatgttctatgccccttggtgtgccatgtgtaag
cggatgatgccatctttccagcaggcagccacagaactaaaaggcacccacgtgctggct
gggatgaatgtctactcctctgaatttgaacacatcaaggaagagtatgatgtccgtggc
taccccaccatctgctattttgagaaagggaagtttctgttccagtatgaaaactatagg
tccacagccaaggacattgtggagtggatgaagaatccacatccaccacagccccaggtc
cccgaggctgcctgggcagacgagggaagcgtcgtgtatcacctgacagatgaagacttt
gacaagtttatgaaggagcactcttctgtcctcatcatgttccatgccccatggtgcggg
cattgtaagaagatgaagcctgagtttgaaagtgcagcagaggccctccatggagtagca
gatagtccaggtgtccttgcagctgttgatgccactgtcaacaaagccattgcagagcga
tatcagatctcagggttccctacactgaaatattttaaggatggagaagaaaagtataca
ttgccacagctcagaacaaagaagaagattattgagtggatgaaaaatcctgaggctcct
ccacccccagagcctgcctgggaagaaaagcaaaccagtgtgctgcacctgactggagtg
gactttcgggaagccctgaagaaaaagaagcatgctcttgtcatgttctatgcaccctgg
tgtccacactgtaaaagtacaatcccgaacttcactgccactgctgaactcttcaaagac
gaccgtaagattgcctgtgctgcagttgactgtgccaaagataagaaccgggatctgtgt
aagcaggaaggggtggatggctaccccaccttcaactactacaactatgggaagatgatt
gaaaaatataatggagatcggacggagtcagggtttgtctcttttgttcgaactctccga
gagcgagaccatgagcgacttggaaaaaagaaagatgaactgtga

DBGET integrated database retrieval system