KEGG   Monodelphis domestica (opossum): 100019161Help
Entry
100019161         CDS       T01031                                 

Definition
histone-lysine N-methyltransferase MLL3-like
Orthology
K09188  
histone-lysine N-methyltransferase MLL3 [EC:2.1.1.43]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:mdo00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 4862 aa AA seqDB search
MSSEEDKSGEQPQPPPPPPPPPPPPPPEEPGAPAAPSPAAADKRPRGRPRKDGASPFQRA
RKKPRNRGRTAVEDDDSMDGLETAETENTVETEVKEQSAEEDGETELDSSKQLTPALQRS
VSMESSSSTVSVGVEAKIREQLCAFCYCGERSSLGQGELKQFCPTPEFIIPWKKQPLNKK
DTDDNSDGTNDKTQYPVPRKQRGQRKERSPRQSITSYVNVSTQTASDDQTGKLWDELSLV
GLPDDIDFQALFESTGHFWAHHRCAEWSLGVCQAEEQALMNVDKAVVSGSTERCAFCKHL
GATIKCCEEKCTQMYHYPCAAGAGTFQDFSNFSLLCPEHIDQAPERSKEEANCAVCDSPG
DLVDQFFCTTCGQHYHGMCLDIAVTPLKRAGWQCPDCKVCQNCKHSGEDSKMLVCDTCDK
GYHTFCLQPIMDSVPTNGWKCKNCRICAECGTRTSSQWHHNCLVCDSCYQPQDNLSCPFC
GKCYQPDLQKDMLHCHMCKRWIHIECDKPADTELDSQLKEEYVCMYCKQLGDMDPVQPCD
EMETSELIPQPVTDSVNEMETEKPDEGLAFLDQAVKSNSVHQELIPEIVPVAVHEGEEEL
TNIKNDNSSERLITGSPLIPDPTHDKLNADVQNEVSHQADEDEMETSDKMVEAIYDESQN
QNKMEVTENDFTLTKMKVSQNEEEPQALQESHTAGPIEESPSPQLTPENITAVSEVSPSI
CIEKTVLITTNELGIEKFQGEIEKDEISEVSSSIVEMESVPSFDSCLKVSSPPEEKLIKS
PSETDSAFSSTADISKRNMCSPSLVSLDLTSTNDMLHNEPSNLHCSAGNIMPTTYISVTP
KIGMGKPAITKRKFSPGRPRSKQGAWSTNNTVSPPSWSPDISEGRDIFKPRQLTGSTIWS
IKVGRGSGFPGKRRPRGAGLSGRGGRGRSKLKSGIGALVLPGVTSMDILSCKDEEENSMH
NTVVLFSSSDKFTLHQDMCVVCGSFGQGAEGRLLACSQCGQCYHPYCVSIKITKVVLSKG
WRCLECTVCEACGKATDPGRLLLCDDCDISYHTYCLDPPLQTVPKGGWKCKWCVWCRHCG
ATSPGPRCEWQNNYTQCAPCASLSICPVCCRNYREEDLILQCRQCDRWMHAVCQNLNTED
EVENVADIGFDCTMCRPYIPTANVPSSDCCESSVVAQIVTKVKELDPPKTYTQDGVCLTE
SGMSHLQSLTVTVPRKKRSKPKLKLKIINQNSVAVLQTPPDIQSEHSRDGEMDDSREGDL
MDCDGKSDSSPEREAVDDDPKGVEGTDGIKKRKRKPYRPGIGGFMVRQRSRTGQGKTKRS
LTRKDSSGSVSEHLPVRDDGWNEQLPDTLVDESIPISDSTEKIKKRYRKRKNKLEETFPA
YLQEAFFGKDLLDTIRQNKLCLDNLSEESASQLPCKTNMNTNFLDPSSDPLLSSTSTPVK
PGTQGNADDPLADLSDVLNTEDDILGILSDDLVKSADPSDIGSISDDPSSLPQPNVNQSS
RPLSEEQLDGILSPELDKMVTDGAILGKLYKIPELGGKKVEKLFPGGLRPGNNQPNSLAQ
PPPPPHLLSLHNQDGVFSRVPLMNGLIGPNPHLPHNSLTPGNGLGNFSSITQSPYTDTRD
KNPVLNPMGSDPHSSWPSSVPTMESESDTLSNTQRSTLKWEKEEALGEIATVAPVLYTNI
NFPNLKEEFPDWTTRVKQIAKLCRKASSQERAPYVQMRQKSKQQAKIEATQKLEQVKNEQ
QQQQQQQQQQFGSQSLVNQSGSDTPSSGIQSPLTPQPGNGSMSPAQSFHKDLFTKPQLPG
PPTTAASDDVFLKPQAPPPPPPPAPVRIPVQEALPQTQTSPSPSSHMFSSGSSSSRPPSP
VDPYAKMVGTPRPLPAGPNFPRRNSVGPVETCTTPLSRSIQVTETTASRLSSARDVCSSS
SASSDPYAKPPDTPRPVVTDQFSKPLGIPRSPIVMEQTGKGPLTAAGTNDPFTKPSPRPD
RFQRQRMPDPYTRPPLTPAPVDSSTGPFKPPMHPPQPQQDPFGSVPQTPRRMSIDPYERP
VLTPRPVDTFAHSQSSDPYSQPPHTPHPAMNDSFAHPSRAFSQSGAMSRQTSQDPYSQPP
GTPHPLADAFSQSSGTPRPIKDPYSQPSATARPTTIDPYIQQSSTPMPSAQADLFVSSPG
NQRHSDPYAHPPGTPRPAIPVPYSQGSALPRPGIPESFTRSPMTRPGLVPNQDTFLQATQ
NRGPTLSGTFVRSSDACSQTPRPPGPALSETFSHVPPSPAHDPYDQPPMTPRPQSDSFGT
SQISHDVVDQQRPGSEGNFNASSNSPMNSQGQQFSTVPQIPGPAPTLAVTDTQNTINMSP
ADTEKLRQRQKLREIILQQQQQKKNAIRQEKGLQDPGSLQHWQPENLNPMFNRPPPPYPG
NIRAPVVPPGGPRFPLFPKERGPFPSDVPGMGIRHHGLRFGFPGGGHGPPSSQERFLVPP
QQMQGPGVPPQLRRSMSVDMPRPLSNSQMNNPVGLTPHFPPQGMQVQQHNILGQAFIELR
HRVPDGRPRLPFNISANNVMEPTSQHHRHGNLIPRTDFQGPRPTDPVRRTSQCIPSQTLV
STNLDHIPSSQQESGQTAHPSSLVMRSLSLPSGNDFAGSSLPTPLSTDESSNLQMPSQPT
DNLEEKLDPDDPSVKDLDVKDLEGVEVKDLDDEDLENLNLDPEDGKGDELDTLGNLETND
PNLDDLLRSGEFDIIAYTDPELDLGDKKSMFNEELDLNVPIDDKLEMQCKTEEPKKDDKI
DRNVISSDKLSPKKKSTIVNEIKTEVLSPHSQEEAKSEKEKSENSTNTACTQLSTETELN
EVEKASSISCDQDRIDNRTNQETVGLNTHVQGSTQMPSQDVTSACSITESTPVLSSLLAN
EKSDNSDIQPLASPPPSLPDTQSNHVSSLPTTLIPPSGPVLDHTMNSNMTVVSRMNHTFS
QSVNVNPGFIHNQPANHSFGTGQSNNQAVSVANPSGPSSMSGPQQLLLPQTLAQQNRERP
LLLEEQPLLLQDLLDQERQEQQQQRQMQAMIRQRSEPFFPNIDFDAITDPIMKAKMVALK
GINKVMAQNNMGMPPMVMNRFPFMSGTQSSEGQNLSQQTIAQDGSLTPQISRPNPPNFGP
GFVNDSQRKQYEEWLQDTQQLLQMQQKYLEEQIGLHRKSKKALSAKQRTAKKAGREFPEE
DAEQLKHVTEQQSMVQKRLEQIRKQQKEHAELIEDYRIKQQQQCAMAPPVLMPGVQPQPT
MVPGGSPSTISQPNFPMASQQLQHQQHTSIIPSQSNPARMPNLPGWQPTSTPPRLPVNAS
RIQPPMPPIPIKPNASAPGSTSNPNPQGGPPPIVEFDDNNPFSESFQERERKERLREQQE
RQRIQLMQEVDRQRVLQQRIEMEQHGMIGSELNNRSLSQIPYFNSDLPCDFMPHPRPLPP
SPQHQQQIGQVLQQPGIQQGSVNSPPNQTFMQTNERRHMGPAPFGPDPSLVPGGGPSFHS
VKQPHGNLSGSNFSQGQIRPSFPPGMPTTPQTANSGLPCGQETTVPHIQNYPGSSQSLIQ
LYSDIIPEEKGKKKRIRKKKKDDDAESTKAPSTPHSDITAPPTPSISEPTSTPTMVTPSE
LNPHPIDPESSEPPGSSTTNEEINQPSSELEDNLSNSGFSQRNPHHQSTEDSESVKFTLE
VSKNIQEIKLEKAEAEQCPGQTEPKLEDQTGIKIEEKVVLSASCPTQLVSVPPSKGDSGN
ELLKHLLKNKKTSSLLNKKSDDNLRLEEERSGNTKLNEKHKSTEGLPIPGNQIQAGLGCG
NNLLTKTDLLSETKKQRNKRTQRTGEKGAPRSKKRKKDEEEKQSLYSNTETFAHLKQQNN
LSNPPTPPASLPPTPPPVTCQKMANGFATTEELAGRAGMLVGHDVTKALGPKQFPLPFKP
QDDLLVRAMAQGPPKTVDVPASLPTPPHNNQEELRVQDPCNDRDTPESFVPSSSPESVVG
MEISRYPDLSLVKEEPPEPVPSPVIPILPSSTGKGSEARQNDIKAEPGSGTLFFTSPFGP
SPNGPKSGLISVAITLHPTAAENINSVVAAFSELLHVRIPNSYEVSNTPDIPSHMALING
SRVNPGLEYRQQLLPHAPPPVSISHGRLVGSYKLKQPNMPFPPTSNGLAGYKDHNQNIAD
NPALRPQWCCHCKVVILGSGVRKSFKGPGFLKQDSQESSDRGEKDIVFCSNNCFVLYSTT
VQGKTSEHKDSIPSLPHSPTKEMPPKAFHQYNTNISTLDVHCLPQLQEKVSPPASPPITF
PPALEAAKVEAKPDELKVTVKLKPRLRAIHSAFDDCRPLSKKWKGMKWKKWSIHIVIPKG
TFKPPCEDEIDEFLKKRGTSLRPDPVPKDYRKCCFCHEEGDGLTDGPARLLNLDLDLWVH
LNCALWSTEVYETQAGALINVELALRRGLQMKCVFCHKMGATGGCHRFRCTNIYHFTCAI
KAQCMFFKDKTMLCPMHKPKGTHEQELSYFAVFRRVYVQRDEVRQIASIVQRGERDHTFR
VGSLIFHTIGQLLPQQMQAFHSSKALFPVGYEASRLYWSTRYANRRCRYLCSIEEKDGLP
IFVIKIVEQGHEDLVLTDTSPKGVWDKILEPVACVRKESEMLQLFPGYLKGEDLFGLTVS
AVARIAESLPGVEACENYTFRYGRNPLMELPLAINPTGCARSEPKMSTHVKRFVLRPHTL
NSTSTSKSFQSTVTGELNAPYSKQFVHSKSSQYRKMKTEWKSNVYLARSRIQGLGLYAAR
DIEKHTMVIEYIGTIIRNEVANRKEKLYESQNRGVYMFRIDNDHVIDATLTGGPARYINH
SCAPNCVAEVVTFERGHKIIISSNRRIQKGEELCYDYKFDFEDDQHKIPCHCGAVNCRKW
MN
NT seq 14589 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcggaagaggacaagagcggggagcagccccagccgccgccgccgccgccgccg
ccgccgccgccgccgcccccagaggagcccggagccccggcggccccgagccccgcagcc
gcagacaaaagacctcggggccggcctcgcaaagatggcgcttcccctttccagagagcc
agaaagaagcctcgaaacagaggaagaactgcagttgaggatgatgatagtatggatggg
ttggagacagcagaaacagaaaacaccgttgaaacagaagtcaaagaacaatctgcggag
gaggatggtgaaacagaattggacagcagcaagcagctaacaccagctctccagcgctca
gtgtctatggaatcctcaagctctactgtttctgttggtgtagaagctaaaatcagagaa
caactatgtgctttttgttactgtggtgaaagaagctcattaggacaaggagaattaaaa
cagttctgtccaacaccagaattcatcatcccctggaaaaagcaacctctgaataagaag
gacactgatgacaacagcgatggaacgaatgacaaaacacaatacccagtgccacgtaaa
caaagaggacagagaaaagagcgatctcctcggcagagcataacatcttatgtaaatgta
agcacccaaactgcttcagatgatcagactggtaaattatgggacgaactcagtctggtt
ggccttccagatgacattgatttccaagccttatttgagtccactggtcacttttgggct
catcaccgttgcgcagaatggtctctgggagtatgccaggcagaagaacaggcattaatg
aacgtggacaaagctgttgtctcagggagcacagaacgatgtgcattttgtaagcacctt
ggagccactatcaaatgctgtgaagaaaaatgtacccagatgtaccattacccttgtgct
gctggagcaggcacttttcaggatttcagtaatttctcccttctctgtccagaacacatt
gaccaggctcctgaaagatctaaggaagaagcaaactgtgctgtgtgtgatagtcctgga
gaccttgtagatcaattcttttgtactacttgtggccagcattaccatggaatgtgcctg
gatatagcagtcacaccattaaagcgagcaggttggcagtgtcctgattgcaaagtgtgc
cagaactgcaagcattctggagaagatagcaagatgctggtatgcgatacatgtgacaaa
ggatatcatactttttgtcttcaaccaattatggattctgtaccaacaaatggctggaaa
tgcaaaaattgcagaatttgtgcagaatgtggcactcgaaccagctcgcagtggcaccac
aattgccttgtgtgtgacagttgttatcaaccacaagataatctatcctgccctttctgt
ggaaagtgttaccaaccagacttgcagaaagacatgttgcattgtcacatgtgcaaaaga
tggattcatatagaatgtgacaaaccagcagatactgaattagattcacagttaaaagaa
gagtatgtctgcatgtattgtaaacagttaggagatatggatccagttcaaccttgtgat
gaaatggagacttctgaactaattccccagcctgtgacagattctgttaatgaaatggaa
acagaaaaacccgatgaaggtttggcatttctggaccaagctgtgaagagtaattctgta
catcaagagttaatccctgaaattgttccagttgctgtccatgaaggtgaagaagaactg
actaatatcaagaatgataattcatcagaaagacttataacaggcagtcctctaattcct
gatcccacacatgataaattaaatgctgatgttcaaaatgaagtttcacatcaagctgat
gaagatgaaatggaaacatctgacaaaatggtagaagccatttatgatgaaagtcaaaat
caaaataagatggaagtgacagaaaatgatttcacactgacaaaaatgaaggtttcacaa
aatgaagaagagccacaggccttacaagagtcccacacagcaggacctattgaagaatca
ccatctccacagttaacacctgaaaatattactgcagtctcagaagtttcaccatctata
tgtatagaaaaaactgttctaattacaacgaatgaattgggaatagaaaagtttcaagga
gaaattgaaaaagatgaaatctctgaagtttcatctagtattgtagaaatggaatctgtc
cctagctttgacagttgtttaaaagttagttcacctccagaagaaaaactcataaaatca
ccatctgagacagattcagcattttcatccacagctgatataagcaagagaaatatgtgt
tccccttccttagtatctttagacttgacatcgacaaatgatatgcttcataatgaacct
tcaaatttacattgttctgctggaaacattatgccaacaacttatatctcagtcactcca
aaaattggcatgggtaaaccagctattaccaaaagaaaattttctccagggagacctcgg
tcaaaacagggggcttggagtaccaataataccgtgagcccaccttcctggtccccagac
atttcagaaggtcgggatatttttaaacccagacagcttactggaagtaccatttggagc
atcaaagtgggtcgtggatctggatttcctgggaaaagaagaccacggggtgcaggactt
tcaggacgaggcgggcgaggtagatccaaactcaaaagtgggattggagctcttgttctt
ccaggggtcacttctatggatattttatcatgtaaagatgaagaagaaaattccatgcat
aacacagtagttctgttttctagcagtgacaaatttactttacatcaggatatgtgtgta
gtttgtggaagctttggccaaggggcagaaggaaggctacttgcatgttctcagtgtggt
cagtgttaccatccatactgtgtcagtattaagatcaccaaagtcgtacttagtaaaggc
tggaggtgtctggaatgtacagtttgtgaagcttgtggcaaggctactgatccaggacga
cttcttctttgtgatgactgtgacataagctatcacacttactgcctggatcctccattg
caaactgttcccaaaggaggctggaagtgtaaatggtgtgtttggtgcagacattgtgga
gcaacatctccaggtccacgatgtgaatggcaaaacaattatacacagtgtgccccatgt
gcaagtttatctatctgtcctgtctgctgtcgaaattatagagaagaggatcttattctg
caatgcagacagtgtgataggtggatgcatgcagtctgccagaatttaaatactgaggat
gaagtagaaaatgtagctgatattgggtttgattgtactatgtgcagaccctatatacct
acagcaaacgtgccttcctcagactgctgtgaatcatcagttgtagcacaaattgttaca
aaagtaaaagagctagatcccccgaagacctacacacaggatggagtttgtttgaccgaa
tcaggaatgtctcatttacagagccttactgttacagttccaagaaaaaagcggtctaaa
ccaaagttgaaactaaagatcataaaccagaatagtgtagctgttctccaaacaccccca
gacatccagtcagagcattcaagggatggtgaaatggatgatagtagagaaggtgatctt
atggattgtgatgggaaatcagattctagtcctgagcgcgaagctgtggatgatgaccct
aagggtgtagaaggaaccgatggaatcaaaaaaagaaaacgaaaaccatatagaccaggt
attggtggcttcatggtacgccaaagaagtcgaactgggcaaggaaaaaccaaacgatct
ttgacaagaaaagattcttcaggttctgtttctgaacatttacctgtcagagatgatggt
tggaatgaacagttaccagatactctggttgatgaatctattcctatctctgacagcact
gagaaaataaagaagagatacagaaaaaggaaaaataagcttgaagaaacttttcctgca
tatctgcaggaagctttctttggaaaagatcttctagatacaattaggcaaaacaagctg
tgcctagataacttgtcagaagaatcagcatctcagctaccttgtaaaactaatatgaac
acaaactttttagatccatcttctgatcccttgcttagctcaacctcaactccagtgaaa
ccaggaactcaaggtaatgctgatgatccattagctgacctctcagatgtattaaacaca
gaagatgatattctaggaatactttctgatgatttagtaaaatctgcagacccttctgat
attggttccatctctgatgatccttcctctttgcctcagccaaacgttaatcaaagttca
cgaccactgagtgaagaacaattagatggcatcctcagtcctgaactagacaaaatggtc
acagatggagcaattcttggaaaattgtataaaattccagaacttggaggaaaaaaagtt
gaaaaattattccccggtggactgaggcctggtaataatcaaccaaattcactggcacaa
cctcctccaccaccacatttactttccttacacaatcaggatggtgttttttctcgggtg
ccacttatgaatggccttattggacctaatcctcatcttccacataattctttgactcct
ggaaatggattaggaaatttctcttctataacacaatccccttatactgataccagggat
aaaaatcctgttctgaatccgatgggaagtgatcctcatagctcctggccatcatcagtc
cctacaatggaaagtgaaagtgatactttgtctaacacccagagaagcactctcaagtgg
gagaaagaagaggcactgggggaaatagcaacagtggcacctgttctctacaccaacatc
aattttcccaacctcaaggaagaattcccagattggaccacaagagtgaagcagattgct
aaattgtgtagaaaagcaagttcacaggaaagagctccatatgtgcaaatgcgacaaaaa
agtaaacagcaagcaaaaattgaagccacacagaaattggaacaagtgaaaaatgaacaa
cagcaacagcagcagcagcagcagcagcagtttggttcccaatcacttgtgaaccagtct
gggtctgacactcctagcagtggaatacaaagccctttaactcctcagcctggtaatgga
agtatgtctcctgcacagtcattccacaaagatctgtttaccaaaccacagctccctgga
cccccgactacagcagcttcagatgatgtatttctaaaaccccaagctcctcctcctcct
cctcctccagcccctgtccgcatcccagtgcaggaagcccttcctcaaactcaaacttct
ccatcaccatcctcacacatgttttcatcaggttcttcaagctcacggcctccctctcca
gtggatccttatgctaaaatggtgggaacccctagaccacttccagcaggtccgaatttt
cctcgaagaaattctgttggaccagtagaaacctgcacaactcccttgtctcgttccatt
caagtaactgaaacaacagcaagtaggctttcatctgccagggatgtgtgttcttcctct
tcagctagtagtgacccctatgcaaaacccccagatacacctaggcctgtggtgacagat
caattttctaaacccttgggcataccgaggtctcccattgttatggaacaaactggaaaa
ggccctttaacagcagctggaacgaatgatcccttcactaaaccatctcctaggccagat
aggtttcaaagacaaaggatgcctgatccatatacacgaccccctctgacacctgcccct
gttgatagtagtactggaccttttaaacctcccatgcaccctcctcaaccccaacaggat
ccttttggatcagtgccacaaacaccaagaagaatgtctattgacccctatgaaaggcct
gttttgacaccaaggccagtagacacttttgcccatagtcagtctagtgatccttatagc
cagcctcctcatactccacatcctgcaatgaatgactcttttgcccatccttcaagggct
ttttctcagtctggggctatgtccaggcaaacttctcaggacccttattcacagcctcca
ggaactcctcatcctctcgcagatgctttttcccagtcctcaggaacacctcgacccatc
aaagatccctattcccaaccttctgcaactgcacgacctaccactattgatccatatatt
cagcagtcttctacccccatgccctctgcacaggcagatttatttgtttcatcaccaggt
aatcaaagacattctgatccttatgcccatcctcctggaacaccacgacctgccatccct
gttccttattcacagggatcagcacttccaaggccagggattccagaaagttttactaga
tccccaatgacaagaccagggcttgtgccaaatcaagatactttcctccaggcaacacaa
aacagaggaccaactttatcagggacttttgtaaggtcatcagatgcatgttctcaaaca
ccaagaccaccaggtcctgctttgtcagaaacttttagtcatgttcctccatcccctgct
catgacccttatgatcagcctccaatgactccaagacctcaatctgattcctttggaact
agtcagatcagccatgatgttgtcgatcagcaaagaccaggatcagaagggaattttaat
gcatcttcaaattctccaatgaattctcaagggcagcaattttctactgtcccccaaatt
cctggtccagcaccaactttagcggtaacagatacacagaataccataaatatgtctcca
gcagatacagaaaagctcagacagaggcagaagttgcgtgaaatcattcttcagcaacaa
caacagaaaaagaatgctatacggcaagaaaaaggattacaagaccctgggtccctgcaa
cactggcaaccagaaaatctcaacccgatgtttaatagaccaccacctccttatcctggg
aacattcgagctcctgttgttccccctggtgggcctagatttccccttttcccaaaagaa
cgaggaccatttccttctgatgttcctggcatgggaataaggcatcatgggttaagattt
ggattcccaggtgggggccatggtccaccatcaagtcaggaacgtttccttgtaccacct
cagcaaatgcagggccctggtgttcctccacagcttcgaagatcaatgtctgtagatatg
cctaggcccttgagcaactcacagatgaataatccagttggacttacaccacattttcca
ccacagggtatgcaagttcaacagcataacatcctgggtcaagcatttattgaattgagg
caccgggtccctgatggaagaccccggcttcccttcaacatttctgctaataatgtcatg
gaaccaacttcccaacaccatcgacatgggaaccttataccacggacagactttcaaggt
ccaagacccacagatccagtcaggcggacatctcagtgtatacctagtcagacattggtg
tctacaaatttggaccatataccatcatctcagcaagagtcgggccaaactgcccaccct
tcttctctcgtcatgcgctctctgagtcttccttcaggaaatgattttgcagggtcttcg
ctgccaactccattatcaactgatgaatctagtaatttacaaatgcccagccaacccact
gataatctagaagaaaagcttgatcctgatgatccttctgtaaaagatttggatgtcaaa
gatctcgaaggggttgaagtcaaagatttggatgatgaagatcttgaaaatttaaacctg
gacccagaagatggcaaaggagatgagttagataccctaggcaatttggaaacaaatgat
cccaaccttgatgacctcttgagatcgggagaatttgatattattgcatatacagatcct
gaacttgatctgggtgataagaaaagtatgtttaatgaggaattggatctaaatgtacca
atcgatgataaattagaaatgcagtgcaaaactgaggaaccaaaaaaggatgacaaaatt
gacaggaatgtaatttcttctgataaactttctccaaagaaaaagtctactattgtgaat
gagataaaaacagaagtactctctccacattcacaagaagaagcaaaatctgaaaaagag
aaaagtgaaaacagtaccaatactgcctgcacccagctttctactgaaactgaattaaat
gaagtagaaaaggcttcttcaatatcttgtgatcaagatagaattgataataggactaat
caggaaactgttgggttaaacacacatgtacaaggatctactcagatgccttctcaagat
gtaacaagtgcctgtagcattactgagtctactccagttctctcaagtttacttgctaat
gagaaatctgataattctgacatacagccattggcgtctcctccaccttctttgccagat
actcaatctaatcatgtgtcaagtttgcctacaactttaataccaccttctggaccagtt
ttggaccatacaatgaattctaatatgactgtggtctccagaatgaaccatactttttct
caaagtgtaaatgtaaatccaggattcatccacaatcagccagcaaatcatagttttggg
actggacaatctaacaatcaagctgtttctgtagcaaatccatctggtccaagtagcatg
tctggaccccagcagttattgcttcctcagacattagctcagcagaatagagaaagacct
cttctacttgaggaacaaccacttcttctccaggacctgttggatcaagagaggcaggaa
caacaacagcagagacagatgcaagccatgattcgccagcgatctgaaccattcttcccc
aatattgattttgatgcaatcacagatcctataatgaaagcaaaaatggtagctcttaaa
gggattaataaagtaatggctcaaaataatatggggatgccaccaatggtcatgaacaga
ttcccctttatgtctgggacacaaagtagtgaaggccagaatctttcccagcagacaatt
gctcaggatggcagtttaacacctcagatttctaggcctaatcctccaaattttggtcca
ggatttgtcaatgattcacaaagaaagcagtatgaagaatggcttcaagatacccaacag
cttctccagatgcaacagaaatatcttgaagaacaaattggactgcacagaaaatctaaa
aaggctctttctgctaagcagcgtactgccaaaaaggctggtcgtgaattcccagaagaa
gatgcagaacaattgaagcatgttacagagcagcagagtatggtccaaaaacggctagaa
cagattcgtaaacaacaaaaagaacatgctgagctcattgaggattatcgaatcaaacag
caacagcaatgtgcaatggccccacctgtcttgatgccaggagtccagcctcagcccaca
atggttcctggagggtcaccatcaacaataagtcagccaaattttccaatggcatcacag
cagcttcaacaccaacagcatacatctattattcctagtcaatccaatcctgcaagaatg
ccaaatttgccaggttggcaacctacaagtacccctcctcgtctccctgtaaatgcttca
aggatacagcctccaatgcctccaatacctataaaacctaatgcttcagctccagggtca
acttcaaatccaaatccacagggtggcccacctcccatagtagaatttgatgacaataac
ccctttagtgaaagttttcaagagcgagaacgtaaggaacgtttacgagaacaacaggaa
agacaaagaattcaactcatgcaagaagtggaccggcagagagttttgcaacagaggata
gaaatggaacagcatggcatgattggatcagaattgaataataggtctttgtcccagatt
ccatatttcaattctgacttaccctgtgatttcatgccacatcctagaccccttccaccg
tctccacaacatcaacagcaaatagggcaggtactacaacagccaggtatacaacaggga
tctgtgaattcaccccctaatcaaacttttatgcagactaatgaaagacggcatatgggt
cctgcaccttttgggcctgacccatcattagttcctggtggtggtccaagtttccattct
gtcaaacagccacatggaaatctttctgggagcaatttttcacaaggccaaataagacct
tcctttcctcctggaatgccaacaacaccacagacagctaatagtggtcttccatgtgga
caggagactacagtgccccacattcaaaactatcctggatcaagccagtctcttattcag
ttgtattctgatataattccagaagaaaaagggaaaaagaaaagaataagaaaaaaaaag
aaagatgatgatgcggagtcaacaaaggcaccatcaactccacattcagatataactgcc
cctccaactccaagtatttcagagcctacctcaaccccaacaatggtcacacccagtgaa
cttaaccctcatcccatagatccagagtcatcagaaccccctggctcttcaactactaat
gaggagataaatcagccatcttcagaattagaagacaatctttccaatagtggtttttct
cagaggaatccacatcatcagtccactgaagactcagaatctgtaaagttcaccttggaa
gtctctaaaaatattcaagaaattaaactggaaaaggctgaggcagaacaatgccctggc
caaactgagcccaaactggaggatcaaactggcattaaaatagaagaaaaagttgtctta
tcagcctcatgtcctacacagttagtaagtgttcctccctcaaaaggagattcagggaat
gagcttttgaaacatttattgaaaaataaaaagacatcttcccttttaaataaaaaatct
gatgataacttgagattagaagaagaacgttctggcaataccaaattaaatgagaaacat
aaatcaactgaaggtctgccaattccaggaaatcagatacaagctggtcttggatgtgga
aataacttgctgaccaaaacagatttactaagtgaaaccaagaagcaacgaaacaaacgg
actcagaggactggagaaaagggagcacctcgttctaagaaaagaaagaaggatgaagag
gaaaaacagtctctttattctaacacagaaacatttgcccacttgaaacagcagaacaac
ttgagtaaccctcccacacctccagcttctctccctcctactcctcctcctgtcacctgt
caaaagatggcaaatggctttgcaactacagaggaacttgctggcagagctggaatgtta
gtgggccatgatgttaccaaagctcttgggcctaaacagtttccactgcccttcaaacca
caggatgacctcctggtcagagctatggcccagggcccccccaagactgtggatgttcct
gcttcacttccaacaccccctcataacaaccaagaagaattaagggtacaggatccatgt
aatgatagggatactcctgagagttttgttccatcttcttctcctgaaagtgtggtagga
atggaaataagcaggtatcctgacctgtcattggttaaagaagaacctccagagcctgtc
ccatctcctgtcattccaattttgccaagcagcactggaaaaggttcagaagccagacaa
aatgatataaaagctgagcctggttcaggcaccctttttttcacctctccatttggccca
tccccaaatgggcctaaatctggccttatatctgtggcaatcactctacatcccacagct
gctgagaatattaatagtgttgtggctgcattttccgaacttctgcatgtacgaattcct
aacagttacgaagtcagtaatactccagatattccttcccacatggccttgataaatggc
tcccgtgtaaaccctggcttagaatatcggcagcagttactcccacatgctcctccacca
gtatccataagccatggaagactagtaggctcttataaactcaaacaaccaaatatgcca
tttcctccaacaagcaatggtttagctggttataaggatcataatcaaaatattgctgat
aaccctgcactcagaccacagtggtgttgtcattgtaaagtggtcattcttggtagtggt
gttcggaaatcttttaaaggtccaggctttctgaaacaggattcccaagaaagctctgat
agaggggaaaaggacattgtattttgtagtaataactgttttgttctttattcaacaact
gtacaaggaaaaacctcagaacacaaggattccatcccctccttgccacactcaccaaca
aaagagatgcctcctaaagcattccatcagtataataccaatatctccactttagatgtc
cattgtctcccacaacttcaggaaaaagtctctccacctgcatcacctcccattactttt
cctcctgccttagaagcagccaaagtagaggcaaagccagatgaactgaaagtaacagta
aaattgaaacctcgtctaagagccatccatagtgcttttgatgattgtagaccactaagt
aagaaatggaaagggatgaaatggaagaaatggagcattcatattgtcattcccaagggg
accttcaaaccaccttgtgaagatgaaattgatgagtttctgaaaaaacgtggcacatcc
ctgagacctgatcctgtgcctaaagactatcgcaagtgctgtttttgtcatgaagaaggg
gatggactaacagatgggccagcacggttgcttaaccttgacttagatctgtgggtccat
ttgaactgtgccctttggtctacagaggtctatgagacacaagctggtgccttaataaat
gtggaactggcccttcggaggggcctacaaatgaaatgtgtgttctgtcacaaaatgggc
gccactggcggctgtcacaggtttaggtgcactaacatttatcactttacctgtgccatt
aaagcacaatgcatgttttttaaagacaaaacaatgctttgccccatgcacaagccaaag
ggaactcatgagcaagaattaagttattttgcagtctttcgaagggtctatgtccaacgt
gatgaggttaggcagatcgctagcattgtgcagcgtggagaacgtgaccacactttccga
gtaggaagcctcatcttccacacaattggtcagctgttaccccagcagatgcaagcattc
cattcttcgaaagctctcttccctgttggatatgaagctagccgactatactggagtacg
cggtatgcaaatcgacgttgtcgctatttatgttctattgaagagaaggatggacttccc
atatttgtgatcaaaattgtggagcaaggccatgaagatcttgttcttactgatacctct
cctaaaggtgtttgggataaaattctggagcctgttgcatgtgttcgaaaagaatctgaa
atgcttcagctctttcctgggtatttaaaaggagaagatctgtttggtttaacagtctct
gctgtggcaagaatagctgaatcacttcctggggttgaggcatgtgaaaactataccttc
cgatatggccggaaccctctcatggaacttcctcttgccattaaccccacgggctgtgcc
cgttctgaacctaaaatgagtactcatgtcaagaggtttgtgttaaggcctcacaccttg
aatagcaccagcacctcgaaatcctttcagagcacagtcacgggagagttgaacgcccct
tacagcaaacagtttgtccattccaaatcctctcaataccggaaaatgaagactgaatgg
aaatccaacgtatatttagcacggtctaggattcagggactaggcttatatgctgctaga
gacattgaaaagcacaccatggtcattgaatacattggaaccatcatccgaaatgaagta
gcaaacagaaaagagaagctttatgagtctcaaaatcggggagtgtacatgttccgcatc
gataatgatcatgtcattgatgccacattgacaggagggcctgcaaggtatatcaaccat
tcatgtgcacctaattgtgtggctgaggtggtgacttttgaaagaggacataaaatcatc
attagttctaatcgaagaatccagaaaggggaagaactttgttatgactataagtttgat
tttgaagatgaccagcacaagattccatgtcactgtggagctgtaaactgccggaaatgg
atgaactaa

DBGET integrated database retrieval system