KEGG   Monodelphis domestica (opossum): 100019161Help
Entry
100019161         CDS       T01031                                 

Gene name
KMT2C
Definition
lysine (K)-specific methyltransferase 2C
Orthology
K09188  
histone-lysine N-methyltransferase MLL3 [EC:2.1.1.43]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    100019161 (KMT2C)
Enzymes [BR:mdo01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100019161 (KMT2C)
Transcription factors [BR:mdo03000]
 Eukaryotic Type
  Zinc finger
   Cys4 Trithorax
    100019161 (KMT2C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 4937 aa AA seqDB search
MSSEEDKSGEQPQPPPPPPPPPPPPPPEEPGAPAAPSPAAADKRPRGRPRKDGASPFQRA
RKKPRNRGRTAVEDDDSMDGLETAETENTVETEVKEQSAEEDGETELDSSKQLTPALQRS
VSMESSSSTVSVGVEAKIREQLCAFCYCGERSSLGQGELKQFCPTPEFIIPWKKQPLNKK
DTDDNSDGTNDKTQYPVPRKQRGQRKERSPRQSITSYVNVSTQTASDDQTGKLWDELSLV
GLPDDIDFQALFESTGHFWAHHRCAEWSLGVCQAEEQALMNVDKAVVSGSTERCAFCKHL
GATIKCCEEKCTQMYHYPCAAGAGTFQDFSNFSLLCPEHIDQAPERSKEEANCAVCDSPG
DLVDQFFCTTCGQHYHGMCLDIAVTPLKRAGWQCPDCKVCQNCKHSGEDSKMLVCDTCDK
GYHTFCLQPIMDSVPTNGWKCKNCRICAECGTRTSSQWHHNCLVCDSCYQPQDNLSCPFC
GKCYQPDLQKDMLHCHMCKRWIHIECDKPADTELDSQLKEEYVCMYCKQLGDMDPVQPCD
EMETSELIPQPVTDSVNEMETEKPDEGLAFLDQAVKSNSVHQELIPEIVPVAVHEGEEEL
TNIKNDNSSERLITGSPLIPDPTHDKLNADVQNEVSHQADEDEMETSDKMVEAIYDESQN
QNKMEVTENDFTLTKMKVSQNEEEPQALQESHTAGPIEESPSPQLTPENITAVSEVSPSI
CIEKTVLITTNELGIEKFQGEIEKDEISEVSSSIVEMESVPSFDSCLKVSSPPEEKLIKS
PSETDSAFSSTADISKRNMCSPSLVSLDLTSTNDMLHNEPSNLHCSAGNIMPTTYISVTP
KIGMGKPAITKRKFSPGRPRSKQGAWSTNNTVSPPSWSPDISEGRDIFKPRQLTGSTIWS
IKVGRGSGFPGKRRPRGAGLSGRGGRGRSKLKSGIGALVLPGVTSMDILSCKDEEENSMH
NTVVLFSSSDKFTLHQDMCVVCGSFGQGAEGRLLACSQCGQCYHPYCVSIKITKVVLSKG
WRCLECTVCEACGKATDPGRLLLCDDCDISYHTYCLDPPLQTVPKGGWKCKWCVWCRHCG
ATSPGPRCEWQNNYTQCAPCASLSICPVCCRNYREEDLILQCRQCDRWMHAVCQNLNTED
EVENVADIGFDCTMCRPYIPTANVPSSDCCESSVVAQIVTKVKELDPPKTYTQDGVCLTE
SGMSHLQSLTVTVPRKKRSKPKLKLKIINQNSVAVLQTPPDIQSEHSRDGEMDDSREGDL
MDCDGKSDSSPEREAVDDDPKGVEGTDGIKKRKRKPYRPGIGGFMVRQRSRTGQGKTKRS
LTRKDSSGSVSEHLPVRDDGWNEQLPDTLVDESIPISDSTEKIKKRYRKRKNKLEETFPA
YLQEAFFGKDLLDTIRQNKLCLDNLSEESASQLPCKTNMNTNFLDPSSDPLLSSTSTPVK
PGTQGNADDPLADLSDVLNTEDDILGILSDDLVKSADPSGLDLCTFQVENSPSPFAGLDI
GSISDDPSSLPQPNVNQSSRPLSEEQLDGILSPELDKMVTDGAILGKLYKIPELGGKKVE
KLFPGGLRPGNNQPNSLAQPPPPPHLLSLHNQDGVFSRVPLMNGLIGPNPHLPHNSLTPG
NGLGNFSSITQSPYTDTRDKNPVLNPMGSDPHSSWPSSVPTMESESDTLSNTQRSTLKWE
KEEALGEIATVAPVLYTNINFPNLKEEFPDWTTRVKQIAKLCRKASSQERAPYVVQMRQK
SKQQAKIEATQKLEQVKNEQQQQQQQQQQQFGSQSLVNQSGSDTPSSGIQSPLTPQPGNG
SMSPAQSFHKDLFTKPQLPGPPTTAASDDVFLKPQAPPPPPPPAPVRIPVQEALPQTQTS
PSPSSHMFSSGSSSSRPPSPVDPYAKMVGTPRPLPAGPNFPRRNSVGPVETCTTPLSRSI
QVTETTASRLSSARDVCSSSSASSDPYAKPPDTPRPVVTDQFSKPLGIPRSPIVMEQTGK
GPLTAAGTNDPFTKPSPRPDRFQRQRMPDPYTRPPLTPAPVDSSTGPFKPPMHPPQPQQD
PFGSVPQTPRRMSIDPYERPVLTPRPVDTFAHSQSSDPYSQPPHTPHPAMNDSFAHPSRA
FSQSGAMSRQTSQDPYSQPPGTPHPLADAFSQSSGTPRPIKDPYSQPSATARPTTIDPYI
QQSSTPMPSAQADLFVSSPGNQRHSDPYAHPPGTPRPAIPVPYSQGSALPRPGIPESFTR
SPMTRPGLVPNQDTFLQATQNRGPTLSGTFVRSSDACSQTPRPPGPALSETFSHVPPSPA
HDPYDQPPMTPRPQSDSFGTSQISHDVVDQQRPGSEGNFNASSNSPMNSQGQQFSTVPQI
PGPAPTLAVTDTQNTINMSPADTEKLRQRQKLREIILQQQQQKKNAIRQEKGLQDPGSLQ
HWQPENLNPMFNRPPPPYPGNIRAPVVPPGGPRFPLFPKERGPFPSDVPGMGIRHHGLRF
GFPGGGHGPPSSQERFLVPPQQMQGPGVPPQLRRSMSVDMPRPLSNSQMNNPVGLTPHFP
PQGMQVQQHNILGQAFIELRHRVPDGRPRLPFNISANNVMEPTSQHHRHGNLIPRTDFQG
PRPTDPVRRTSQCIPSQTLVSTNLDHIPSSQQESGQTAHPSSLVMRSLSLPSGNDFAGSS
LPTPLSTDESSNLQMPSQPTDNLEEKLDPDDPSVKDLDVKDLEGVEVKDLDDEDLENLNL
DPEDGKGDELDTLGNLETNDPNLDDLLRSGEFDIIAYTDPELDLGDKKSMFNEELDLNVP
IDDKLEMQCKTEEPKKDDKIDRNVISSDKLSPKKKSTIVNEIKTEVLSPHSQEEAKSEKE
KSENSTNTACTQLSTETELNEVEKASSISCDQDRIDNRTNQETVGLNTHVQGSTQMPSQD
VTSACSITESTPVLSSLLANEKSDNSDIQPLASPPPSLPDTQSNHVSSLPTTLIPPSGPV
LDHTMNSNMTVVSRMNHTFSQSVNVNPGFIHNQPANHSFGTGQSNNQAVSVANPSGPSSM
SGPQQLLLPQTLAQQNRERPLLLEEQPLLLQDLLDQERQEQQQQRQMQAMIRQRSEPFFP
NIDFDAITDPIMKAKMVALKGINKVMAQNNMGMPPMVMNRFPFMSGTQSSEGQNLSQQTI
AQDGSLTPQISRPNPPNFGPGFVNDSQRKQYEEWLQDTQQLLQMQQKYLEEQIGLHRKSK
KALSAKQRTAKKAGREFPEEDAEQLKHVTEQQSMVQKRLEQIRKQQKEHAELIEDYRIKQ
QQQCAMAPPVLMPGVQPQPTMVPGGSPSTISQPNFPMASQQLQHQQHTSIIPSQSNPARM
PNLPGWQPTSTPPRLPVNASRIQPPMPPIPIKPNASAPGSTSNPNPQGGPPPIVEFDDNN
PFSESFQERERKERLREQQERQRIQLMQEVDRQRVLQQRIEMEQHGMIGSELNNRSLSQI
PYFNSDLPCDFMPHPRPLPPSPQHQQQIGQVLQQPGIQQGSVNSPPNQTFMQTNERRHMG
PAPFGPDPSLVPGGGPSFHSVKQPHGNLSGSNFSQGQIRPSFPPGMPTTPQTANSGLPCG
QETTVPHIQNYPGSSQSLIQLYSDIIPEEKGKKKRIRKKKKDDDAESTKAPSTPHSDITA
PPTPSISEPTSTPTMVTPSELNPHPIDPESSEPPGSSTTNEEINQPSSELEDNLSNSGFS
QRNPHHQSTEDSESVKFTLEVSKNIQEIKLEKAEAEQCPGQTEPKLEDQTGIKIEEKVVL
SASCPTQLVSVPPSKGDSGNELLKHLLKNKKTSSLLNKKSDDNLRLEEERSGNTKLNEKH
KSTEGLPIPGNQIQAGLGCGNNLLTKTDLLSETKKQRNKRTQRTGEKGAPRSKKRKKDEE
EKQSLYSNTETFAHLKQQLSLLPLMEPIIGVNFAHFLPYGSGQYNSGNRLLGAFGSATLE
GVSDYYSQLIYKQNNLSNPPTPPASLPPTPPPVTCQKMANGFATTEELAGRAGMLVGHDV
TKALGPKQFPLPFKPQDDLLVRAMAQGPPKTVDVPASLPTPPHNNQEELRVQDPCNDRDT
PESFVPSSSPESVVGMEISRYPDLSLVKEEPPEPVPSPVIPILPSSTGKGSEARQNDIKA
EPGSGTLFFTSPFGPSPNGPKSGLISVAITLHPTAAENINSVVAAFSELLHVRIPNSYEV
SNTPDIPSHMALINGSRVNPGLEYRQQLLPHAPPPVSISHGRLVGSYKLKQPNMPFPPTS
NGLAGYKDHNQNIADNPALRPQWCCHCKVVILGSGVRKSFKGPGFLKQDSQESSDRGEKD
IVFCSNNCFVLYSTTVQGKTSEHKDSIPSLPHSPTKEMPPKAFHQYNTNISTLDVHCLPQ
LQEKVSPPASPPITFPPALEAAKVEAKPDELKVTVKLKPRLRAIHSAFDDCRPLSKKWKG
MKWKKWSIHIVIPKGTFKPPCEDEIDEFLKKRGTSLRPDPVPKDYRKCCFCHEEGDGLTD
GPARLLNLDLDLWVHLNCALWSTEVYETQAGALINVELALRRGLQMKCVFCHKMGATGGC
HRFRCTNIYHFTCAIKAQCMFFKDKTMLCPMHKPKGTHEQELSYFAVFRRVYVQRDEVRQ
IASIVQRGERDHTFRVGSLIFHTIGQLLPQQMQAFHSSKALFPVGYEASRLYWSTRYANR
RCRYLCSIEEKDGLPIFVIKIVEQGHEDLVLTDTSPKGVWDKILEPVACVRKESEMLQLF
PGYLKGEDLFGLTVSAVARIAESLPGVEACENYTFRYGRNPLMELPLAINPTGCARSEPK
MSTHVKRFVLRPHTLNSTSTSKSFQSTVTGELNAPYSKQFVHSKSSQYRKMKTEWKSNVY
LARSRIQGLGLYAARDIEKHTMVIEYIGTIIRNEVANRKEKLYESQNRGVYMFRIDNDHV
IDATLTGGPARYINHSCAPNCVAEVVTFERGHKIIISSNRRIQKGEELCYDYKFDFEDDQ
HKIPCHCGAVNCRKWMN
NT seq 14814 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcggaagaggacaagagcggggagcagccccagccgccgccgccgccgccgccg
ccgccgccgccgccgcccccagaggagcccggagccccggcggccccgagccccgcagcc
gcagacaaaagacctcggggccggcctcgcaaagatggcgcttcccctttccagagagcc
agaaagaagcctcgaaacagaggaagaactgcagttgaggatgatgatagtatggatggg
ttggagacagcagaaacagaaaacaccgttgaaacagaagtcaaagaacaatctgcggag
gaggatggtgaaacagaattggacagcagcaagcagctaacaccagctctccagcgctca
gtgtctatggaatcctcaagctctactgtttctgttggtgtagaagctaaaatcagagaa
caactatgtgctttttgttactgtggtgaaagaagctcattaggacaaggagaattaaaa
cagttctgtccaacaccagaattcatcatcccctggaaaaagcaacctctgaataagaag
gacactgatgacaacagcgatggaacgaatgacaaaacacaatacccagtgccacgtaaa
caaagaggacagagaaaagagcgatctcctcggcagagcataacatcttatgtaaatgta
agcacccaaactgcttcagatgatcagactggtaaattatgggacgaactcagtctggtt
ggccttccagatgacattgatttccaagccttatttgagtccactggtcacttttgggct
catcaccgttgcgcagaatggtctctgggagtatgccaggcagaagaacaggcattaatg
aacgtggacaaagctgttgtctcagggagcacagaacgatgtgcattttgtaagcacctt
ggagccactatcaaatgctgtgaagaaaaatgtacccagatgtaccattacccttgtgct
gctggagcaggcacttttcaggatttcagtaatttctcccttctctgtccagaacacatt
gaccaggctcctgaaagatctaaggaagaagcaaactgtgctgtgtgtgatagtcctgga
gaccttgtagatcaattcttttgtactacttgtggccagcattaccatggaatgtgcctg
gatatagcagtcacaccattaaagcgagcaggttggcagtgtcctgattgcaaagtgtgc
cagaactgcaagcattctggagaagatagcaagatgctggtatgcgatacatgtgacaaa
ggatatcatactttttgtcttcaaccaattatggattctgtaccaacaaatggctggaaa
tgcaaaaattgcagaatttgtgcagaatgtggcactcgaaccagctcgcagtggcaccac
aattgccttgtgtgtgacagttgttatcaaccacaagataatctatcctgccctttctgt
ggaaagtgttaccaaccagacttgcagaaagacatgttgcattgtcacatgtgcaaaaga
tggattcatatagaatgtgacaaaccagcagatactgaattagattcacagttaaaagaa
gagtatgtctgcatgtattgtaaacagttaggagatatggatccagttcaaccttgtgat
gaaatggagacttctgaactaattccccagcctgtgacagattctgttaatgaaatggaa
acagaaaaacccgatgaaggtttggcatttctggaccaagctgtgaagagtaattctgta
catcaagagttaatccctgaaattgttccagttgctgtccatgaaggtgaagaagaactg
actaatatcaagaatgataattcatcagaaagacttataacaggcagtcctctaattcct
gatcccacacatgataaattaaatgctgatgttcaaaatgaagtttcacatcaagctgat
gaagatgaaatggaaacatctgacaaaatggtagaagccatttatgatgaaagtcaaaat
caaaataagatggaagtgacagaaaatgatttcacactgacaaaaatgaaggtttcacaa
aatgaagaagagccacaggccttacaagagtcccacacagcaggacctattgaagaatca
ccatctccacagttaacacctgaaaatattactgcagtctcagaagtttcaccatctata
tgtatagaaaaaactgttctaattacaacgaatgaattgggaatagaaaagtttcaagga
gaaattgaaaaagatgaaatctctgaagtttcatctagtattgtagaaatggaatctgtc
cctagctttgacagttgtttaaaagttagttcacctccagaagaaaaactcataaaatca
ccatctgagacagattcagcattttcatccacagctgatataagcaagagaaatatgtgt
tccccttccttagtatctttagacttgacatcgacaaatgatatgcttcataatgaacct
tcaaatttacattgttctgctggaaacattatgccaacaacttatatctcagtcactcca
aaaattggcatgggtaaaccagctattaccaaaagaaaattttctccagggagacctcgg
tcaaaacagggggcttggagtaccaataataccgtgagcccaccttcctggtccccagac
atttcagaaggtcgggatatttttaaacccagacagcttactggaagtaccatttggagc
atcaaagtgggtcgtggatctggatttcctgggaaaagaagaccacggggtgcaggactt
tcaggacgaggcgggcgaggtagatccaaactcaaaagtgggattggagctcttgttctt
ccaggggtcacttctatggatattttatcatgtaaagatgaagaagaaaattccatgcat
aacacagtagttctgttttctagcagtgacaaatttactttacatcaggatatgtgtgta
gtttgtggaagctttggccaaggggcagaaggaaggctacttgcatgttctcagtgtggt
cagtgttaccatccatactgtgtcagtattaagatcaccaaagtcgtacttagtaaaggc
tggaggtgtctggaatgtacagtttgtgaagcttgtggcaaggctactgatccaggacga
cttcttctttgtgatgactgtgacataagctatcacacttactgcctggatcctccattg
caaactgttcccaaaggaggctggaagtgtaaatggtgtgtttggtgcagacattgtgga
gcaacatctccaggtccacgatgtgaatggcaaaacaattatacacagtgtgccccatgt
gcaagtttatctatctgtcctgtctgctgtcgaaattatagagaagaggatcttattctg
caatgcagacagtgtgataggtggatgcatgcagtctgccagaatttaaatactgaggat
gaagtagaaaatgtagctgatattgggtttgattgtactatgtgcagaccctatatacct
acagcaaacgtgccttcctcagactgctgtgaatcatcagttgtagcacaaattgttaca
aaagtaaaagagctagatcccccgaagacctacacacaggatggagtttgtttgaccgaa
tcaggaatgtctcatttacagagccttactgttacagttccaagaaaaaagcggtctaaa
ccaaagttgaaactaaagatcataaaccagaatagtgtagctgttctccaaacaccccca
gacatccagtcagagcattcaagggatggtgaaatggatgatagtagagaaggtgatctt
atggattgtgatgggaaatcagattctagtcctgagcgcgaagctgtggatgatgaccct
aagggtgtagaaggaaccgatggaatcaaaaaaagaaaacgaaaaccatatagaccaggt
attggtggcttcatggtacgccaaagaagtcgaactgggcaaggaaaaaccaaacgatct
ttgacaagaaaagattcttcaggttctgtttctgaacatttacctgtcagagatgatggt
tggaatgaacagttaccagatactctggttgatgaatctattcctatctctgacagcact
gagaaaataaagaagagatacagaaaaaggaaaaataagcttgaagaaacttttcctgca
tatctgcaggaagctttctttggaaaagatcttctagatacaattaggcaaaacaagctg
tgcctagataacttgtcagaagaatcagcatctcagctaccttgtaaaactaatatgaac
acaaactttttagatccatcttctgatcccttgcttagctcaacctcaactccagtgaaa
ccaggaactcaaggtaatgctgatgatccattagctgacctctcagatgtattaaacaca
gaagatgatattctaggaatactttctgatgatttagtaaaatctgcagacccttctggt
cttgatttatgcactttccaggttgagaactcaccttccccatttgctggcctagatatt
ggttccatctctgatgatccttcctctttgcctcagccaaacgttaatcaaagttcacga
ccactgagtgaagaacaattagatggcatcctcagtcctgaactagacaaaatggtcaca
gatggagcaattcttggaaaattgtataaaattccagaacttggaggaaaaaaagttgaa
aaattattccccggtggactgaggcctggtaataatcaaccaaattcactggcacaacct
cctccaccaccacatttactttccttacacaatcaggatggtgttttttctcgggtgcca
cttatgaatggccttattggacctaatcctcatcttccacataattctttgactcctgga
aatggattaggaaatttctcttctataacacaatccccttatactgataccagggataaa
aatcctgttctgaatccgatgggaagtgatcctcatagctcctggccatcatcagtccct
acaatggaaagtgaaagtgatactttgtctaacacccagagaagcactctcaagtgggag
aaagaagaggcactgggggaaatagcaacagtggcacctgttctctacaccaacatcaat
tttcccaacctcaaggaagaattcccagattggaccacaagagtgaagcagattgctaaa
ttgtgtagaaaagcaagttcacaggaaagagctccatatgtggtacaaatgcgacaaaaa
agtaaacagcaagcaaaaattgaagccacacagaaattggaacaagtgaaaaatgaacaa
cagcaacagcagcagcagcagcagcagcagtttggttcccaatcacttgtgaaccagtct
gggtctgacactcctagcagtggaatacaaagccctttaactcctcagcctggtaatgga
agtatgtctcctgcacagtcattccacaaagatctgtttaccaaaccacagctccctgga
cccccgactacagcagcttcagatgatgtatttctaaaaccccaagctcctcctcctcct
cctcctccagcccctgtccgcatcccagtgcaggaagcccttcctcaaactcaaacttct
ccatcaccatcctcacacatgttttcatcaggttcttcaagctcacggcctccctctcca
gtggatccttatgctaaaatggtgggaacccctagaccacttccagcaggtccgaatttt
cctcgaagaaattctgttggaccagtagaaacctgcacaactcccttgtctcgttccatt
caagtaactgaaacaacagcaagtaggctttcatctgccagggatgtgtgttcttcctct
tcagctagtagtgacccctatgcaaaacccccagatacacctaggcctgtggtgacagat
caattttctaaacccttgggcataccgaggtctcccattgttatggaacaaactggaaaa
ggccctttaacagcagctggaacgaatgatcccttcactaaaccatctcctaggccagat
aggtttcaaagacaaaggatgcctgatccatatacacgaccccctctgacacctgcccct
gttgatagtagtactggaccttttaaacctcccatgcaccctcctcaaccccaacaggat
ccttttggatcagtgccacaaacaccaagaagaatgtctattgacccctatgaaaggcct
gttttgacaccaaggccagtagacacttttgcccatagtcagtctagtgatccttatagc
cagcctcctcatactccacatcctgcaatgaatgactcttttgcccatccttcaagggct
ttttctcagtctggggctatgtccaggcaaacttctcaggacccttattcacagcctcca
ggaactcctcatcctctcgcagatgctttttcccagtcctcaggaacacctcgacccatc
aaagatccctattcccaaccttctgcaactgcacgacctaccactattgatccatatatt
cagcagtcttctacccccatgccctctgcacaggcagatttatttgtttcatcaccaggt
aatcaaagacattctgatccttatgcccatcctcctggaacaccacgacctgccatccct
gttccttattcacagggatcagcacttccaaggccagggattccagaaagttttactaga
tccccaatgacaagaccagggcttgtgccaaatcaagatactttcctccaggcaacacaa
aacagaggaccaactttatcagggacttttgtaaggtcatcagatgcatgttctcaaaca
ccaagaccaccaggtcctgctttgtcagaaacttttagtcatgttcctccatcccctgct
catgacccttatgatcagcctccaatgactccaagacctcaatctgattcctttggaact
agtcagatcagccatgatgttgtcgatcagcaaagaccaggatcagaagggaattttaat
gcatcttcaaattctccaatgaattctcaagggcagcaattttctactgtcccccaaatt
cctggtccagcaccaactttagcggtaacagatacacagaataccataaatatgtctcca
gcagatacagaaaagctcagacagaggcagaagttgcgtgaaatcattcttcagcaacaa
caacagaaaaagaatgctatacggcaagaaaaaggattacaagaccctgggtccctgcaa
cactggcaaccagaaaatctcaacccgatgtttaatagaccaccacctccttatcctggg
aacattcgagctcctgttgttccccctggtgggcctagatttccccttttcccaaaagaa
cgaggaccatttccttctgatgttcctggcatgggaataaggcatcatgggttaagattt
ggattcccaggtgggggccatggtccaccatcaagtcaggaacgtttccttgtaccacct
cagcaaatgcagggccctggtgttcctccacagcttcgaagatcaatgtctgtagatatg
cctaggcccttgagcaactcacagatgaataatccagttggacttacaccacattttcca
ccacagggtatgcaagttcaacagcataacatcctgggtcaagcatttattgaattgagg
caccgggtccctgatggaagaccccggcttcccttcaacatttctgctaataatgtcatg
gaaccaacttcccaacaccatcgacatgggaaccttataccacggacagactttcaaggt
ccaagacccacagatccagtcaggcggacatctcagtgtatacctagtcagacattggtg
tctacaaatttggaccatataccatcatctcagcaagagtcgggccaaactgcccaccct
tcttctctcgtcatgcgctctctgagtcttccttcaggaaatgattttgcagggtcttcg
ctgccaactccattatcaactgatgaatctagtaatttacaaatgcccagccaacccact
gataatctagaagaaaagcttgatcctgatgatccttctgtaaaagatttggatgtcaaa
gatctcgaaggggttgaagtcaaagatttggatgatgaagatcttgaaaatttaaacctg
gacccagaagatggcaaaggagatgagttagataccctaggcaatttggaaacaaatgat
cccaaccttgatgacctcttgagatcgggagaatttgatattattgcatatacagatcct
gaacttgatctgggtgataagaaaagtatgtttaatgaggaattggatctaaatgtacca
atcgatgataaattagaaatgcagtgcaaaactgaggaaccaaaaaaggatgacaaaatt
gacaggaatgtaatttcttctgataaactttctccaaagaaaaagtctactattgtgaat
gagataaaaacagaagtactctctccacattcacaagaagaagcaaaatctgaaaaagag
aaaagtgaaaacagtaccaatactgcctgcacccagctttctactgaaactgaattaaat
gaagtagaaaaggcttcttcaatatcttgtgatcaagatagaattgataataggactaat
caggaaactgttgggttaaacacacatgtacaaggatctactcagatgccttctcaagat
gtaacaagtgcctgtagcattactgagtctactccagttctctcaagtttacttgctaat
gagaaatctgataattctgacatacagccattggcgtctcctccaccttctttgccagat
actcaatctaatcatgtgtcaagtttgcctacaactttaataccaccttctggaccagtt
ttggaccatacaatgaattctaatatgactgtggtctccagaatgaaccatactttttct
caaagtgtaaatgtaaatccaggattcatccacaatcagccagcaaatcatagttttggg
actggacaatctaacaatcaagctgtttctgtagcaaatccatctggtccaagtagcatg
tctggaccccagcagttattgcttcctcagacattagctcagcagaatagagaaagacct
cttctacttgaggaacaaccacttcttctccaggacctgttggatcaagagaggcaggaa
caacaacagcagagacagatgcaagccatgattcgccagcgatctgaaccattcttcccc
aatattgattttgatgcaatcacagatcctataatgaaagcaaaaatggtagctcttaaa
gggattaataaagtaatggctcaaaataatatggggatgccaccaatggtcatgaacaga
ttcccctttatgtctgggacacaaagtagtgaaggccagaatctttcccagcagacaatt
gctcaggatggcagtttaacacctcagatttctaggcctaatcctccaaattttggtcca
ggatttgtcaatgattcacaaagaaagcagtatgaagaatggcttcaagatacccaacag
cttctccagatgcaacagaaatatcttgaagaacaaattggactgcacagaaaatctaaa
aaggctctttctgctaagcagcgtactgccaaaaaggctggtcgtgaattcccagaagaa
gatgcagaacaattgaagcatgttacagagcagcagagtatggtccaaaaacggctagaa
cagattcgtaaacaacaaaaagaacatgctgagctcattgaggattatcgaatcaaacag
caacagcaatgtgcaatggccccacctgtcttgatgccaggagtccagcctcagcccaca
atggttcctggagggtcaccatcaacaataagtcagccaaattttccaatggcatcacag
cagcttcaacaccaacagcatacatctattattcctagtcaatccaatcctgcaagaatg
ccaaatttgccaggttggcaacctacaagtacccctcctcgtctccctgtaaatgcttca
aggatacagcctccaatgcctccaatacctataaaacctaatgcttcagctccagggtca
acttcaaatccaaatccacagggtggcccacctcccatagtagaatttgatgacaataac
ccctttagtgaaagttttcaagagcgagaacgtaaggaacgtttacgagaacaacaggaa
agacaaagaattcaactcatgcaagaagtggaccggcagagagttttgcaacagaggata
gaaatggaacagcatggcatgattggatcagaattgaataataggtctttgtcccagatt
ccatatttcaattctgacttaccctgtgatttcatgccacatcctagaccccttccaccg
tctccacaacatcaacagcaaatagggcaggtactacaacagccaggtatacaacaggga
tctgtgaattcaccccctaatcaaacttttatgcagactaatgaaagacggcatatgggt
cctgcaccttttgggcctgacccatcattagttcctggtggtggtccaagtttccattct
gtcaaacagccacatggaaatctttctgggagcaatttttcacaaggccaaataagacct
tcctttcctcctggaatgccaacaacaccacagacagctaatagtggtcttccatgtgga
caggagactacagtgccccacattcaaaactatcctggatcaagccagtctcttattcag
ttgtattctgatataattccagaagaaaaagggaaaaagaaaagaataagaaaaaaaaag
aaagatgatgatgcggagtcaacaaaggcaccatcaactccacattcagatataactgcc
cctccaactccaagtatttcagagcctacctcaaccccaacaatggtcacacccagtgaa
cttaaccctcatcccatagatccagagtcatcagaaccccctggctcttcaactactaat
gaggagataaatcagccatcttcagaattagaagacaatctttccaatagtggtttttct
cagaggaatccacatcatcagtccactgaagactcagaatctgtaaagttcaccttggaa
gtctctaaaaatattcaagaaattaaactggaaaaggctgaggcagaacaatgccctggc
caaactgagcccaaactggaggatcaaactggcattaaaatagaagaaaaagttgtctta
tcagcctcatgtcctacacagttagtaagtgttcctccctcaaaaggagattcagggaat
gagcttttgaaacatttattgaaaaataaaaagacatcttcccttttaaataaaaaatct
gatgataacttgagattagaagaagaacgttctggcaataccaaattaaatgagaaacat
aaatcaactgaaggtctgccaattccaggaaatcagatacaagctggtcttggatgtgga
aataacttgctgaccaaaacagatttactaagtgaaaccaagaagcaacgaaacaaacgg
actcagaggactggagaaaagggagcacctcgttctaagaaaagaaagaaggatgaagag
gaaaaacagtctctttattctaacacagaaacatttgcccacttgaaacagcagctctct
ctgcttcctctaatggaaccaatcattggagtgaattttgcacactttcttccttatggc
agtggccaatataatagtggaaatcgccttctaggagcttttggcagtgccacccttgaa
ggggtctcagattactattctcaattgatctacaagcagaacaacttgagtaaccctccc
acacctccagcttctctccctcctactcctcctcctgtcacctgtcaaaagatggcaaat
ggctttgcaactacagaggaacttgctggcagagctggaatgttagtgggccatgatgtt
accaaagctcttgggcctaaacagtttccactgcccttcaaaccacaggatgacctcctg
gtcagagctatggcccagggcccccccaagactgtggatgttcctgcttcacttccaaca
ccccctcataacaaccaagaagaattaagggtacaggatccatgtaatgatagggatact
cctgagagttttgttccatcttcttctcctgaaagtgtggtaggaatggaaataagcagg
tatcctgacctgtcattggttaaagaagaacctccagagcctgtcccatctcctgtcatt
ccaattttgccaagcagcactggaaaaggttcagaagccagacaaaatgatataaaagct
gagcctggttcaggcaccctttttttcacctctccatttggcccatccccaaatgggcct
aaatctggccttatatctgtggcaatcactctacatcccacagctgctgagaatattaat
agtgttgtggctgcattttccgaacttctgcatgtacgaattcctaacagttacgaagtc
agtaatactccagatattccttcccacatggccttgataaatggctcccgtgtaaaccct
ggcttagaatatcggcagcagttactcccacatgctcctccaccagtatccataagccat
ggaagactagtaggctcttataaactcaaacaaccaaatatgccatttcctccaacaagc
aatggtttagctggttataaggatcataatcaaaatattgctgataaccctgcactcaga
ccacagtggtgttgtcattgtaaagtggtcattcttggtagtggtgttcggaaatctttt
aaaggtccaggctttctgaaacaggattcccaagaaagctctgatagaggggaaaaggac
attgtattttgtagtaataactgttttgttctttattcaacaactgtacaaggaaaaacc
tcagaacacaaggattccatcccctccttgccacactcaccaacaaaagagatgcctcct
aaagcattccatcagtataataccaatatctccactttagatgtccattgtctcccacaa
cttcaggaaaaagtctctccacctgcatcacctcccattacttttcctcctgccttagaa
gcagccaaagtagaggcaaagccagatgaactgaaagtaacagtaaaattgaaacctcgt
ctaagagccatccatagtgcttttgatgattgtagaccactaagtaagaaatggaaaggg
atgaaatggaagaaatggagcattcatattgtcattcccaaggggaccttcaaaccacct
tgtgaagatgaaattgatgagtttctgaaaaaacgtggcacatccctgagacctgatcct
gtgcctaaagactatcgcaagtgctgtttttgtcatgaagaaggggatggactaacagat
gggccagcacggttgcttaaccttgacttagatctgtgggtccatttgaactgtgccctt
tggtctacagaggtctatgagacacaagctggtgccttaataaatgtggaactggccctt
cggaggggcctacaaatgaaatgtgtgttctgtcacaaaatgggcgccactggcggctgt
cacaggtttaggtgcactaacatttatcactttacctgtgccattaaagcacaatgcatg
ttttttaaagacaaaacaatgctttgccccatgcacaagccaaagggaactcatgagcaa
gaattaagttattttgcagtctttcgaagggtctatgtccaacgtgatgaggttaggcag
atcgctagcattgtgcagcgtggagaacgtgaccacactttccgagtaggaagcctcatc
ttccacacaattggtcagctgttaccccagcagatgcaagcattccattcttcgaaagct
ctcttccctgttggatatgaagctagccgactatactggagtacgcggtatgcaaatcga
cgttgtcgctatttatgttctattgaagagaaggatggacttcccatatttgtgatcaaa
attgtggagcaaggccatgaagatcttgttcttactgatacctctcctaaaggtgtttgg
gataaaattctggagcctgttgcatgtgttcgaaaagaatctgaaatgcttcagctcttt
cctgggtatttaaaaggagaagatctgtttggtttaacagtctctgctgtggcaagaata
gctgaatcacttcctggggttgaggcatgtgaaaactataccttccgatatggccggaac
cctctcatggaacttcctcttgccattaaccccacgggctgtgcccgttctgaacctaaa
atgagtactcatgtcaagaggtttgtgttaaggcctcacaccttgaatagcaccagcacc
tcgaaatcctttcagagcacagtcacgggagagttgaacgccccttacagcaaacagttt
gtccattccaaatcctctcaataccggaaaatgaagactgaatggaaatccaacgtatat
ttagcacggtctaggattcagggactaggcttatatgctgctagagacattgaaaagcac
accatggtcattgaatacattggaaccatcatccgaaatgaagtagcaaacagaaaagag
aagctttatgagtctcaaaatcggggagtgtacatgttccgcatcgataatgatcatgtc
attgatgccacattgacaggagggcctgcaaggtatatcaaccattcatgtgcacctaat
tgtgtggctgaggtggtgacttttgaaagaggacataaaatcatcattagttctaatcga
agaatccagaaaggggaagaactttgttatgactataagtttgattttgaagatgaccag
cacaagattccatgtcactgtggagctgtaaactgccggaaatggatgaactaa

DBGET integrated database retrieval system