KEGG   Monodelphis domestica (opossum): 100019249Help
Entry
100019249         CDS       T01031                                 

Gene name
ST6GAL2
Definition
ST6 beta-galactosamide alpha-2,6-sialyltranferase 2
Orthology
K00779  
beta-galactoside alpha2,6-sialyltransferase (sialyltransferase 2) [EC:2.4.99.1]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
N-Glycan biosynthesis
Other types of O-glycan biosynthesis
Metabolic pathways
Module
N-glycan biosynthesis, complex type
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    100019249 (ST6GAL2)
   00514 Other types of O-glycan biosynthesis
    100019249 (ST6GAL2)
Enzymes [BR:mdo01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.1  beta-galactoside alpha-2,6-sialyltransferase
     100019249 (ST6GAL2)
Glycosyltransferases [BR:mdo01003]
 Terminal extension
  Sialyltransferase
   100019249 (ST6GAL2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
7
AA seq 518 aa AA seqDB search
MKPNLKQWKQLMLFGIFAWGLLFLVIFIYFTDSNTVEPVPSSFSFVETKRILPIQGKQRS
IMGAMHDPSFSATIDGNEVLLNGDLFDSFNSGPNSLQKWTEMKDGLENEEFFPSQMRKKS
PRIFYQGEDDYFFTMGQPMSHSHGQQMVKFITLSEEDQKGGIRHNQKRIISRHRRSQLPH
NWDRLYSTMSKSFLYRLWKGNVSSKMLNPRLQKAMKDYLTTNKHRVRFRGKRNSKLTREQ
LLCELRDRVSVRTLDGKEAPFSDLGWEKHVPQEPLSKLYPQGLGSCAVVMSAGAILNSSL
GEEIDSHDAVLRFNSAPTHGYERDVGNKTTMRIINSQILTNPNHHFIDSSLYKDVILVAW
DPAPYSANLHMWYKKPDYNLFTPYIQHRRKNPNQPFYILHPKFIWQLWDIIQENTKEKIQ
PNPPSSGFIGILIMMSLCKEVHVYEYIPSVRQTDLCHYHELYYDAACTLGAYHPLLYEKL
LVQRMNQGIRDDLYRKGKAILPGFRAISCPAPNHFPNP
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
atgaaaccgaacttaaaacaatggaaacaactaatgctcttcgggatatttgcttggggt
ctcctttttttagtgatcttcatctacttcacagatagcaacactgtggagccagttccg
agttccttctcatttgttgaaactaaaaggatcctgcctattcaaggaaaacagagatca
atcatgggcgccatgcatgacccatctttttctgcaaccatcgatgggaatgaggtgctt
ctcaacggagatctttttgattcatttaactcaggtcccaacagtcttcagaaatggact
gaaatgaaagatggtttggagaatgaagagttttttccttctcagatgagaaaaaaatcc
ccacgcattttttatcaaggggaggatgactatttttttactatgggccaacctatgtca
cacagccatggccagcagatggtgaagttcatcaccctcagtgaggaggaccagaaaggg
ggcatcagacacaatcaaaagagaattatctcaaggcacaggagaagtcagttgccccac
aattgggatagactctattcgaccatgtctaagtcctttctttaccgactttggaaagga
aatgtctcttcaaaaatgctaaatccacgcctacaaaaagcaatgaaagattatcttacc
accaacaagcacagggtgagatttaggggaaagcggaactccaagctgacaagggaacag
ctcttgtgtgagctcagggaccgagtaagtgtaaggaccctggatgggaaggaagccccc
ttttcagacctcggctgggagaagcatgtccctcaagagcccctgagcaaactgtatcct
cagggtttgggtagctgtgcagtagtcatgtctgcaggtgcaatcctgaattcctctctg
ggcgaagaaatagattctcatgatgcagttttgaggtttaactctgctcctacacatggt
tatgaaagagatgttggaaataaaacaaccatgcgcatcattaattcccagattctgacc
aacccaaatcatcacttcattgatagttcattatataaggatgtcattttagtggcttgg
gaccctgctccatactcggcaaatcttcacatgtggtataagaagccagactacaatctc
ttcactccctatattcagcatcgtaggaagaacccaaatcaacccttttatattcttcat
cctaaatttatttggcaactctgggacataatccaagagaacacaaaagagaagattcaa
ccaaatcctccatcttctggtttcatagggatactcatcatgatgtctctgtgcaaagaa
gtgcacgtgtatgaatatattccatctgtacgacaaaccgatctctgccactatcatgaa
ctatactatgatgcagcctgtactctgggggcctaccatcccctgctctatgagaagctc
ctggtgcaaaggatgaaccaaggcatccgggatgacctgtaccgaaagggaaaagcgatc
ctgccagggtttcgggctatcagctgtcctgcacctaatcattttccaaatccttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system