KEGG   Monodelphis domestica (opossum): 100019305Help
Entry
100019305         CDS       T01031                                 

Gene name
KAT8, MYST1
Definition
K(lysine) acetyltransferase 8
Orthology
K11308  
histone acetyltransferase MYST1 [EC:2.3.1.48]
Organism
mdo  Monodelphis domestica (opossum)
Brite
Enzymes [BR:mdo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100019305 (KAT8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
6
AA seq 455 aa AA seqDB search
MATASSAAAATVGAPGEGEPGGGERTVAEGTSPPPGRASPPAPARGEPEVTVEIGETYLC
RRPDSTWHSAEVIQSRVNDQEGREEFYVHYVGFNRRLDEWVDKNRLALTKTVKEAVQKNS
EKYLSELAEQPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHEAITKVKYVDKIH
IGNYEIDAWYFSPFPEDYGKQPKLWLCEYCLKYMKFEKSYRFHLGQCQWRQPPGKEIYRK
NNISVYEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFVFYILTEVDRQGAHIVGYFS
KEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLESTVGSPEKPLSDLGKLSYRS
YWSWVLLEILRDFRGTLSIKDLSQMTSITQNDIISTLQSLNMVKYWKGQHVICVTPKLVE
EHLKSAQYKKPPITVDSVCLKWAPPKHKQVKLSKK
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggcgacggctagctcagctgcggccgctacggtcggagccccaggggagggcgagcct
gggggcggggagagaacggtggctgaagggacctccccgcccccaggccgcgcctcccca
ccggccccggcccgcggtgagcctgaggtcacggtggagatcggagaaacgtacctctgc
cgacgtccggatagtacttggcattcagcagaagtgattcagtcccgggtgaatgaccag
gaaggaagagaggaattctacgtacattatgtgggctttaaccgtcggctggatgaatgg
gtggacaagaatcgactggccttgaccaagacagtgaaggaagctgttcagaagaactct
gagaaataccttagcgaactagctgagcagcctgaacgcaagatcacccgcaaccagaaa
cgcaagcatgatgagatcaaccatgtgcagaagacctatgcggagatggatcccacaaca
gcagcactagagaaggaacatgaggcgattaccaaggtgaagtatgtggataagattcat
attggaaactatgagattgatgcctggtacttctccccatttccagaagattatgggaaa
cagcccaaactttggctctgcgaatactgtctcaaatacatgaagtttgaaaagagctac
cgtttccatttggggcagtgccagtggagacagccacctggcaaggaaatctatcgaaag
aacaatatctcggtgtatgaagtagatggcaaagaccataagatttattgccagaacctg
tgtctgttggccaagctcttcctggatcacaagaccctgtactttgatgtggaaccattt
gtcttctacatcttgacagaggtggacagacagggggcccacattgtgggctacttctct
aaggagaaggagtccccagatgggaataatgtggcctgtatcctgactctccccccatat
cagcgtcgaggttatggcaagttccttattgctttcagttacgaattgtccaagttggag
agtactgtgggttctccagagaaaccactgtcagaccttggcaaactgagctatcggagt
tactggtcctgggtgctactggaaatcctgagggactttcggggtacattatccatcaaa
gacctcagccagatgaccagcatcacacaaaatgacatcatcagcactctgcagtcactc
aacatggtcaagtactggaaggggcagcatgtcatctgcgtcacccccaagctagtggaa
gagcaccttaagagtgcccagtacaagaaaccacccataacagtggactctgtttgcctc
aagtgggcaccacccaagcacaagcaagtaaagctgtccaagaagtga

DBGET integrated database retrieval system