KEGG   Monodelphis domestica (opossum): 100019356Help
Entry
100019356         CDS       T01031                                 

Gene name
NLK
Definition
(RefSeq) nemo like kinase
  KO
K04468  nemo like kinase [EC:2.7.11.24]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
mdo04010  MAPK signaling pathway
mdo04068  FoxO signaling pathway
mdo04310  Wnt signaling pathway
mdo04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    100019356 (NLK)
   04310 Wnt signaling pathway
    100019356 (NLK)
   04068 FoxO signaling pathway
    100019356 (NLK)
 Cellular Processes
  Cellular community - eukaryotes
   04520 Adherens junction
    100019356 (NLK)
Enzymes [BR:mdo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100019356 (NLK)
Protein kinases [BR:mdo01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   100019356 (NLK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Haspin_kinase Kinase-like FTA2
Motif
Other DBs
NCBI-GeneID: 100019356
NCBI-ProteinID: XP_001368494
Ensembl: ENSMODG00000019231
UniProt: F6RE45
Position
2
AA seq 528 aa AA seqDB search
MSLCGTAANAKMMAAYNGGTSAAAAAGHHHHHHHHLPHLPPPHLHHHHHPQHHLHPGSAA
AVHPVQQHTSSAAAAAAAAAAAAAMLNPGQQQPYFPSPAPGQAPGPAATAPAQVQAAAAA
AVKAHHHQHSHHPQQQLDIEPDRPIGYGAFGVVWSVTDPRDGKRVALKKMPNVFQNLVSC
KRVFRELKMLCFFKHDNVLSALDILQPPHIDYFEEIYVVTELMQSDLHKIIVSPQPLSSD
HVKVFLYQILRGLKYLHSAGILHRDIKPGNLLVNSNCVLKICDFGLARVEELDESRHMTQ
EVVTQYYRAPEILMGSRHYSNAIDIWSVGCIFAELLGRRILFQAQSPIQQLDLITDLLGT
PSLEAMRTACEGAKAHILRGPHKQPSLPVLYTLSSQATHEAVHLLCRMLVFDPSKRISAK
DALAHPYLDEGRLRYHTCMCKCCFSTSTGRVYTSDFEPITNPKFDDTFEKNLSSVRQVKE
IIHQFILEQQKGNRVPLCINPQSAAFKSFISSTVAQPSEMPPSPLVWE
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgtctctttgtggcacggcagccaacgcaaaaatgatggcggcttataatggtggtaca
tctgcagcggcagcagcaggtcaccaccaccaccatcaccaccaccttccacaccttcct
cctccacaccttcaccaccaccaccaccctcaacaccatcttcatcccggatcagctgct
gccgtccatccagtgcagcagcatacctcttcagcggctgccgcggctgctgcagccgcg
gcggctgctgccatgttaaaccccgggcaacaacagccatatttcccatcaccggcacca
ggtcaggcccctggaccagctgccacggccccagctcaggtacaggctgcagcagccgct
gcagttaaagcgcaccatcatcagcactcacatcatccacaacagcaactggatattgag
ccggacagacctattggatatggagcctttggtgttgtctggtcagtaacagatccaaga
gatggaaagagagtcgctctcaaaaagatgcccaacgtcttccagaatcttgtctcttgc
aaaagggtcttccgagaactgaagatgttgtgtttttttaagcatgataacgtactctct
gcccttgacatactccagcctccacacattgactattttgaagaaatctatgttgtcaca
gaattgatgcagagtgacctacataaaattatcgtctctcctcaaccactcagctcagat
catgtcaaagtttttctttatcagattttaagaggtttgaaatatcttcattcagccggc
attttacatcgcgacattaagccagggaatctccttgtgaacagcaactgtgtgcttaag
atttgcgactttggattggccagagtggaggaactggatgaatcccgtcatatgactcag
gaagttgtcactcagtattatcgggcccccgagatcctgatgggcagccgtcattacagc
aatgctattgacatctggtctgtaggctgcatctttgcagagctgctaggacgaagaata
ttgtttcaggcacagagtcccattcaacagttggatttgatcacagatttactgggcaca
ccatcactggaagcaatgaggacagcttgcgaaggtgcaaaggcacacatactcaggggt
cctcataaacagccatctcttcctgtactctatacactgtctagccaagcaacacatgaa
gctgttcatctcctttgcaggatgttggtctttgatccatccaaaagaatatctgctaag
gacgccttagcccacccctacctagatgaagggcggttgcgataccacacctgtatgtgt
aaatgttgtttttccacctccactggaagagtttataccagtgactttgaacccatcacc
aatcccaaatttgatgacacttttgagaagaatctcagttctgttcgacaggtaaaagaa
attattcatcagttcattttggaacagcagaaaggaaaccgagtgcctctctgcatcaac
cctcaatctgctgcttttaagagcttcattagttccactgttgcccagccatctgagatg
ccgccatctccactggtctgggagtga

DBGET integrated database retrieval system