KEGG   Monodelphis domestica (opossum): 100019452Help
Entry
100019452         CDS       T01031                                 

Gene name
DYRK4
Definition
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 4
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
mdo  Monodelphis domestica (opossum)
Brite
Enzymes [BR:mdo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100019452 (DYRK4)
Protein kinases [BR:mdo01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [Table]
   100019452 (DYRK4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 689 aa AA seqDB search
MESFWHECPEPLATSLTPLPSILLSLRTKMNARKLGKRSTTSFPILKPRKKYNFSSIKKF
PGAILSGVHSRSISKPSSQVESKAQNQQPKSKNNNLRLNQYLRKKTNTSAPSLPYLDNRC
GKKNTVSVVKILPQDHNLPLITTKSLVKVLSMSQESQHHNLGLPSDIKISSNLCSPSQNF
KSEEIMTSYKFPLTAAEALKHFKNQLSVYERNEVLGYTELWFLGLEAQKLDVLPEKHSKT
SFDDEHGSYIKVLHDHIAYRYEVLEMIGKGSFGQVAKCLDHKKNELVALKIIRNKKRFHH
QALVELKILEALRKKDKDNTYNVVHMKEFFYFRNHLCITFELLGINLYELMKNNSFQGFS
LTVIRRFTVSVLKCLQMLHVEKIIHCDLKPENIVLYQRGQVSVKVIDFGSSCYEHQRVYT
YIQSRFYRSPEVILGHPYDTAIDMWSLGCILAELYTGYPLFAGENEVEQLACIMEVLGLP
PIYLIQTASRRQTFFDSKGFPKNITNNRGKKRYPDSKDLTTVLKTCDTGFLDFLKKCLIW
DPALRMTPDQALKHAWIQESKSLKARSKNQNMKKASLCFLAEKKDKVQQPPRLGKSAEKP
PRAEVTDTTKEGATESDQQPDDQQGPVQPLGEGKMEVAGITCVWLPPLTDAPGKLEADDE
ESEECTDSEGESSKETSPKNSTSFLPPIV
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atggaatccttttggcatgaatgcccagaacctctagctacttccttgacacctcttcct
tctattctcctctcactaaggacaaaaatgaatgcaagaaagcttggaaaacgaagtaca
acgtcctttcccattctgaaaccaagaaagaaatacaacttcagttctataaagaagttt
cctggagcaattttgtctggtgtacattcaagatcaatttcaaaaccgtcatcccaagtg
gagagtaaggctcaaaaccaacaacccaagtccaagaacaacaacctgaggctaaaccaa
tatttgcgtaagaaaaccaacactagtgctccctcactcccttatctggacaatcgttgt
gggaagaagaacacagtcagcgtagtaaagatccttcctcaagaccataacctcccactc
atcaccacaaaaagcttggtgaaggtactctcaatgtctcaggaaagccaacaccacaac
ctggggttaccctctgatatcaagatttcatcgaacctctgcagcccaagtcagaacttc
aagtcagaggaaattatgacatcctacaagtttcctctgacagctgcagaagccctaaaa
cattttaagaatcaactatctgtgtatgaacgaaatgaagtcctgggctacacagaatta
tggttcctggggcttgaggcccagaagttagatgtacttcctgaaaaacacagcaagaca
agctttgatgatgagcatggctcctatattaaggtcctgcatgatcacattgcctaccgt
tatgaggtcctggagatgattggcaaaggatcctttgggcaagtggccaagtgtttggat
cacaaaaagaatgaattggtggcactgaaaatcatcaggaacaaaaagagatttcaccat
caagcccttgtagagttaaagatcctagaagccctccgaaagaaagataaagataacaca
tacaatgtggttcatatgaaggaattcttttatttccggaatcacctctgcattaccttt
gaacttctggggattaatttatatgagttgatgaagaataacagctttcagggtttcagc
ctgactgtaattcggcgcttcacagtctcagttctgaagtgtttgcaaatgctgcatgta
gagaaaatcattcactgtgatctgaagccagagaacattgttctataccaaaggggccaa
gtatcagttaaagttattgactttggctcaagctgctatgaacatcaaagagtgtacact
tacatccagagtcgtttctaccgttccccggaggtgattctgggccatccctatgacacc
gccattgacatgtggagtttgggctgcattctggcagagctgtacactggctacccactt
tttgctggggagaatgaagtagaacagctggcctgcattatggaggtgctgggtctacca
ccaatctacttaattcagactgcctccaggaggcaaacattctttgattccaaaggtttt
cctaaaaatataaccaacaacagggggaaaaaaagatatccagactccaaggatcttact
acagtgctgaaaacctgtgataccggctttctggactttctgaaaaagtgcttgatatgg
gaccctgctcttcgaatgactcctgaccaggctctcaagcatgcctggattcaggagtca
aagagccttaaagcacggtccaaaaaccagaacatgaagaaagccagcctctgcttcctt
gcagaaaagaaggataaagtccagcaaccaccccgcttgggaaaatcagcagaaaagccc
cccagggcagaggtcacagatacaaccaaagaaggagccactgagagtgatcaacagcct
gatgaccagcagggccctgttcaacctttgggtgaaggcaaaatggaagtcgcagggata
acctgtgtctggttgccacctttaacagatgctccaggaaaactagaggcagatgatgag
gaatcagaggagtgtacagactccgagggagaaagtagcaaagagacatctcccaagaac
tctacatcctttttaccacccattgtatga

DBGET integrated database retrieval system