KEGG   Monodelphis domestica (opossum): 100019504Help
Entry
100019504         CDS       T01031                                 

Definition
galactocerebrosidase-like
Orthology
K01202  
galactosylceramidase [EC:3.2.1.46]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:mdo00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100019504
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100019504
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.46  galactosylceramidase
     100019504
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 690 aa AA seqDB search
MSPLKVWTNRLRGLLLQWLLLLSLLSATGSFRSKIFTKHVLRSNLSTSFYVLDDTPGLDR
VFDGIGGVSGGGATSRLLVNYPEPYRSEILDYLFKPNFGASLHILKVEIGGDGQTTDGTE
PSHMHYKGDENYFRGYEWWLMKEAKKRNPNIKLIGLPWSFPGWIGSGKSWPYDSPSITAL
YIVSWILGAKKYHNLDIDYIGIWNERSFDIQYIKILRKMLNQKDLDRVKIIASDNLWLPI
SISMLLDDELLDAVDVIGAHYPGTHTVQDALKTNKSLWSSEDYSTFNNEVGGGCWARILN
QNFVNGHMTSTIAWNLVASYYPQLPFGRDGLMTAQEPWSSHYVVETPIWISAHTTQFAQP
GWRYLKTVGHLQNGGSYVALTDGLGNLTIIIETMTHEHSKCIRPPLPFFLVSEQTTTFSL
QGTFKELRMLQVWYSKLGKKPWNDTFLFKQLPPLKITNGTVTLQLGLDEVYTLTTITTGQ
KGSHPTPPESRPFPSNFEDNFNVGNPPFSEAPNFADQTGVFEYFTNDQDTSGHSFTLRQV
LTQRPITWAMDADQTISIIGDHNWRDITITCDVYMETPVTGGIFIAGRVNKGGSFIRSAQ
GVFFWILANGTYEVTGDLERRRIIKGGKANVMAKKWYTLTLNITDSSAYGILNNRVLWKT
QLRPLPRNGWAAIGTRSFEFGQFDNFHIQA
NT seq 2073 nt NT seq  +upstreamnt  +downstreamnt
atgtctcctttaaaggtttggactaaccgcctacgggggttgttgctgcagtggctgctg
cttctttcgcttctgagcgccactgggtcgttcagatctaaaatttttacgaagcacgtg
cttcgctccaacctcagcacatctttttacgtcttggatgatactcccgggcttgatcgg
gtattcgatgggatcggcggggtgagcggaggcggggcaacctcccgacttctggtcaat
tatcctgagccttatcggtctgaaatattggattatttgtttaagccaaactttggtgct
tctttacatattctgaaagtggaaataggtggtgatggacaaacgacagatggcactgaa
ccctcccatatgcactataaaggcgatgagaactatttccggggctatgaatggtggttg
atgaaggaagctaagaagaggaatcccaatattaaacttattgggttgccatggtcattt
cctggttggataggttcaggtaaaagctggccctatgacagtccctccattactgcatta
tatattgtgtcttggatattgggtgctaaaaagtatcataatttggacattgattatatt
gggatttggaatgagagatcatttgacattcagtatataaagatattaagaaaaatgctt
aatcaaaaagacctggacagagtgaaaatcatagctagtgataacctctggctgcccatt
tccatttccatgctacttgatgatgaactcctggatgccgttgatgttattggggctcat
tatcctggaacccatactgtacaggatgctttgaagaccaacaaaagcctctggtcttct
gaagattatagtacttttaataatgaagtgggtggaggctgctgggctcgcatcttgaac
cagaattttgtgaatggccacatgacttccacaattgcttggaacttagtggctagttac
tatccacaactaccttttgggagagatggattgatgactgctcaggagccttggagtagc
cattatgttgtagagactcctatctggatttcagctcataccactcagtttgctcaacca
gggtggcgatacctaaaaacagttggccatttacaaaatggtggaagctatgtagctctt
acagatggcttaggtaacctcactattatcattgaaaccatgactcatgaacattcgaaa
tgcataaggccacctcttcctttttttctggtgtctgaacaaactaccactttctctctt
cagggaacctttaaagaattaagaatgctacaggtatggtattccaaacttggaaaaaaa
ccttggaatgacactttcttattcaaacaactacctcctctaaagattactaatggaaca
gtcacattacaattgggtttggatgaagtgtatactttaacaaccatcactacaggtcaa
aagggcagtcatcctactcctccagaatcacggccatttccatctaactttgaagataat
ttcaatgttggcaatccaccttttagtgaagctccaaattttgccgatcaaacaggtgta
ttcgaatacttcaccaatgaccaggacacatcaggtcattccttcaccttacgccaagtg
ctcactcagagacctatcacttgggctatggatgcagatcagaccatcagtattatagga
gatcataactggagggatataacaataacttgtgatgtgtacatggagacaccggtgacg
ggtggcatattcattgctggaagagtaaataagggtgggtcattcattcgaagtgcccaa
ggagttttcttctggattttggcaaatgggacatatgaagttacaggtgatcttgagagg
aggaggataataaagggaggaaaagctaatgtcatggctaaaaaatggtacactctcact
ctgaatattactgactcctctgcttatggcatactaaataatagggttctctggaaaact
cagctaaggccattacccaggaatggttgggcagcaattggaacacgtagcttcgagttt
ggacagtttgataactttcacatccaggcttaa

DBGET integrated database retrieval system