KEGG   Monodelphis domestica (opossum): 100019504Help
Entry
100019504         CDS       T01031                                 

Definition
galactocerebrosidase-like
Orthology
K01202  
galactosylceramidase [EC:3.2.1.46]
Organism
mdo  Monodelphis domestica (opossum)
Pathway
Sphingolipid metabolism
Metabolic pathways
Lysosome
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:mdo00600]
Cellular Processes; Transport and catabolism; Lysosome [PATH:mdo04142]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 659 aa AA seqDB search
MHPPEAIYLDPITLPEGAPLSMLVSERNTVCRGASKRGVAHATSRLLVNYPEPYRSEILD
YLFKPNFGASLHILKVEIGGDGQTTDGTEPSHMHYKGDENYFRGYEWWLMKEAKKRNPNI
KLIGLPWSFPGWIGSGKSWPYDSPSITALYIVSWILGAKKYHNLDIDYIGIWNERSFDIQ
YIKILRKMLNQKDLDRVKIIASDNLWLPISISMLLDDELLDAVDVIGAHYPGTHTVQDAL
KTNKSLWSSEDYSTFNNEVGGGCWARILNQNFVNGHMTSTIAWNLVASYYPQLPFGRDGL
MTAQEPWSSHYVVETPIWISAHTTQFAQPGWRYLKTVGHLQNGGSYVALTDGLGNLTIII
ETMTHEHSKCIRPPLPFFLVSEQTTTFSLQGTFKELRMLQVWYSKLGKKPWNDTFLFKQL
PPLKITNGTVTLQLGLDEVYTLTTITTGQKGSHPTPPESRPFPSNFEDNFNVGNPPFSEA
PNFADQTGVFEYFTNDQDTSGHSFTLRQVLTQRPITWAMDADQTISIIGDHNWRDITITC
DVYMETPVTGGIFIAGRVNKGGSFIRSAQGVFFWILANGTYEVTGDLAGTLIIKGGKANV
MAKKWYTLTLNITDSSAYGILNNRVLWKTQLRPLPRNGWAAIGTRSFEFGQFDNFHIQA
NT seq 1980 nt NT seq  +upstreamnt  +downstreamnt
atgcatccccctgaggccatttatctggaccccatcactcttccagaaggggcacctctt
tcaatgttggtcagtgagaggaacactgtatgccgtggagcttcaaagcgtggtgtcgct
cacgcaacctcccgacttctggtcaattatcctgagccttatcggtctgaaatattggat
tatttgtttaagccaaactttggtgcttctttacatattctgaaagtggaaataggtggt
gatggacaaacgacagatggcactgaaccctcccatatgcactataaaggcgatgagaac
tatttccggggctatgaatggtggttgatgaaggaagctaagaagaggaatcccaatatt
aaacttattgggttgccatggtcatttcctggttggataggttcaggtaaaagctggccc
tatgacagtccctccattactgcattatatattgtgtcttggatattgggtgctaaaaag
tatcataatttggacattgattatattgggatttggaatgagagatcatttgacattcag
tatataaagatattaagaaaaatgcttaatcaaaaagacctggacagagtgaaaatcata
gctagtgataacctctggctgcccatttccatttccatgctacttgatgatgaactcctg
gatgccgttgatgttattggggctcattatcctggaacccatactgtacaggatgctttg
aagaccaacaaaagcctctggtcttctgaagattatagtacttttaataatgaagtgggt
ggaggctgctgggctcgcatcttgaaccagaattttgtgaatggccacatgacttccaca
attgcttggaacttagtggctagttactatccacaactaccttttgggagagatggattg
atgactgctcaggagccttggagtagccattatgttgtagagactcctatctggatttca
gctcataccactcagtttgctcaaccagggtggcgatacctaaaaacagttggccattta
caaaatggtggaagctatgtagctcttacagatggcttaggtaacctcactattatcatt
gaaaccatgactcatgaacattcgaaatgcataaggccacctcttcctttttttctggtg
tctgaacaaactaccactttctctcttcagggaacctttaaagaattaagaatgctacag
gtatggtattccaaacttggaaaaaaaccttggaatgacactttcttattcaaacaacta
cctcctctaaagattactaatggaacagtcacattacaattgggtttggatgaagtgtat
actttaacaaccatcactacaggtcaaaagggcagtcatcctactcctccagaatcacgg
ccatttccatctaactttgaagataatttcaatgttggcaatccaccttttagtgaagct
ccaaattttgccgatcaaacaggtgtattcgaatacttcaccaatgaccaggacacatca
ggtcattccttcaccttacgccaagtgctcactcagagacctatcacttgggctatggat
gcagatcagaccatcagtattataggagatcataactggagggatataacaataacttgt
gatgtgtacatggagacaccggtgacgggtggcatattcattgctggaagagtaaataag
ggtgggtcattcattcgaagtgcccaaggagttttcttctggattttggcaaatgggaca
tatgaagttacaggtgatcttgctgggacgttgataataaagggaggaaaagctaatgtc
atggctaaaaaatggtacactctcactctgaatattactgactcctctgcttatggcata
ctaaataatagggttctctggaaaactcagctaaggccattacccaggaatggttgggca
gcaattggaacacgtagcttcgagtttggacagtttgataactttcacatccaggcttaa

DBGET integrated database retrieval system