KEGG   Monodelphis domestica (opossum): 100019607Help
Entry
100019607         CDS       T01031                                 

Gene name
CES3
Definition
carboxylesterase 3
Orthology
K15743  
carboxylesterase 3/5 [EC:3.1.1.1]
Organism
mdo  Monodelphis domestica (opossum)
Brite
Enzymes [BR:mdo01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.1  carboxylesterase
     100019607 (CES3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 563 aa AA seqDB search
MSGGKKSLLWSLTCTAWLLMLPGEGQEAAQPEVMTQLGLVRGKHVAVKGTDRLVDVFLGI
PFAKPPLGAGRFSPPQPAEPWKGVKDATAFPPMCLQELERTDLMKNTLDGKQQLFPISED
CLYLNIYTPTSRQKKDKLPVMFWIHGGSLAIGSASSQDGSPLSAYEDIVVVLVQYRLGIQ
GFLSTGDELAPGNWGFLDLVAALQWVQGNIAHFGGDPGSVTISGQSAGGAAVSLLVLSPL
TKGLFHRAISQSGVSILPGMLTNNPFPIFQTIAQVFGCEGSSSAILIQCLRNKDNMIFTR
NLSSLPLIPMTVDGVFLLKLPEKMFSENEFPRVPYLLGVNNHEFGWSIPLAWFSKDLENG
MKKEIALNMLKNRSLIMGIPPELIHLAADVYIGNQTDPLAIQNAALDIFGDMFILQSLKF
SEDLRDSGVPVYFYEFQHRPSAFDKIKPAYVRADHSAELPFIWGGPFMTDEGSMLAFPDS
TEEEKQLSRAMMRYWANFIRTGDPNGEGLPNWPLFDQSESYLEFNLTLKIRRKLKEDKMG
FWRKFIHEKVKPYVEGKKAHVEL
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggagggaagaagtctctgctttggtctctgacctgcactgcctggctcctgatg
ctcccaggtgaggggcaagaggctgcacagcctgaagtgatgacccagcttggtctggtc
cgtgggaaacacgtggctgtcaagggaactgaccgtcttgtggatgttttcctgggaatc
ccatttgccaagcctcctctgggagctgggagattctctcctccacagcctgcggagcct
tggaagggtgtaaaagatgccactgcattccccccaatgtgtttacaggaattagaaagg
acagacctcatgaaaaatactttagatgggaagcagcaactcttcccaatatctgaagac
tgtctctatctcaatatctacactccaacctccagacagaagaaggataagttacctgtt
atgttctggatccatggtgggtcactagcaattggatcagcttcctcacaggatggatca
cctttatcagcctatgaagatattgttgtggtactggtgcaatacagattaggaatccag
ggattcttgagcactggggatgagcttgcacctggcaactggggattcttggacctggtg
gctgctttacaatgggtccagggcaacattgctcactttggaggagatcccggctctgtg
accatctctggacaatcagcgggaggagctgctgtctctctccttgttttgtctccactg
accaaaggcctattccatagagccatatcacagagtggggtttccattttaccaggcatg
ttgacaaataatccttttcccatttttcaaactattgctcaagtctttggctgtgaaggt
tccagctctgccattttgatccagtgcttacggaataaagataacatgatattcactagg
aatttgtcatctctgccattaatcccgatgacagtggatggtgtttttttactaaagctc
ccagaaaagatgttctcagagaatgaatttccaagagtcccctatttacttggggtcaac
aatcatgaatttgggtggtcaatacctttggcatggttttctaaggatctggaaaatgga
atgaaaaaagaaattgcactcaacatgttgaagaacagaagccttatcatgggcatcccc
cctgaactgatccatctggccgcagatgtgtatattggtaaccagacagacccattagcc
attcagaatgcagctctggacatatttggagacatgtttattcttcaaagtctgaaattt
tcggaggatctcagagattctggtgttccagtctacttttatgagttccagcatcggcca
agtgcttttgataaaatcaaacctgcttatgtaagagctgaccattcagctgaactccca
ttcatttgggggggcccttttatgacagatgaaggctccatgctggcttttccagactcc
actgaggaagagaagcagctaagcagagcaatgatgagatactgggccaattttattcgc
acaggggaccccaatggagaagggttgcccaactggcctctttttgaccaatcagagtca
tacctagagttcaacttgaccttaaagatcagaagaaaactcaaagaagacaagatggga
ttttggagaaaattcattcatgaaaaagtcaagccatatgttgaaggaaagaaagcacac
gtcgaattgtga

DBGET integrated database retrieval system