KEGG   Monodelphis domestica (opossum): 100019607Help
Entry
100019607         CDS       T01031                                 

Definition
carboxylesterase 3-like
Orthology
K15743  
carboxylesterase 3/5 [EC:3.1.1.1]
Organism
mdo  Monodelphis domestica (opossum)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 535 aa AA seqDB search
MSGGKKSLLWSLTCTAWLLMLPGEGQEAAQPEVMTQLGLVRGKHVAVKGTDRLVDVFLGI
PFAKPPLGAGRFSPPQPAEPWKGVKDATAFPPMCLQELERTDLMKNTLDGKQQLFPISED
CLYLNIYTPTSRQKKDKLPVMFWIHGGSLAIGSASSQDGSPLSAYEDIVVVLVQYRLGIQ
GFLSTGDELAPGNWGFLDLVAALQWVQGNIAHFGGDPGSVTISGQSAGGAAVSLLVLSPL
TKGLFHRAISQSGVSILPGMLTNNPFPIFQTIAQVFGCEGSSSAILIQCLRNKDNMIFTR
NLSSLPLIPMTVDGVFLLKLPEKMFSENEFPRVPYLLGVNNHEFGWSIPLVRGIPPELIH
LAADVYIGNQTDPLAIQNAALDIFGDMFILQSLKFSEDLRDSGVPVYFYEFQHRPSAFDK
IKPAYVRADHSAELPFIWGGPFMTDEGSMLDSTEEEKQLSRAMMRYWANFIRTGDPNGEG
LPNWPLFDQSESYLEFNLTLKIRRKLKEDKMGFWRKFIHEKVKPYVEGKKAHVEL
NT seq 1608 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggagggaagaagtctctgctttggtctctgacctgcactgcctggctcctgatg
ctcccaggtgaggggcaagaggctgcacagcctgaagtgatgacccagcttggtctggtc
cgtgggaaacacgtggctgtcaagggaactgaccgtcttgtggatgttttcctgggaatc
ccatttgccaagcctcctctgggagctgggagattctctcctccacagcctgcggagcct
tggaagggtgtaaaagatgccactgcattccccccaatgtgtttacaggaattagaaagg
acagacctcatgaaaaatactttagatgggaagcagcaactcttcccaatatctgaagac
tgtctctatctcaatatctacactccaacctccagacagaagaaggataagttacctgtt
atgttctggatccatggtgggtcactagcaattggatcagcttcctcacaggatggatca
cctttatcagcctatgaagatattgttgtggtactggtgcaatacagattaggaatccag
ggattcttgagcactggggatgagcttgcacctggcaactggggattcttggacctggtg
gctgctttacaatgggtccagggcaacattgctcactttggaggagatcccggctctgtg
accatctctggacaatcagcgggaggagctgctgtctctctccttgttttgtctccactg
accaaaggcctattccatagagccatatcacagagtggggtttccattttaccaggcatg
ttgacaaataatccttttcccatttttcaaactattgctcaagtctttggctgtgaaggt
tccagctctgccattttgatccagtgcttacggaataaagataacatgatattcactagg
aatttgtcatctctgccattaatcccgatgacagtggatggtgtttttttactaaagctc
ccagaaaagatgttctcagagaatgaatttccaagagtcccctatttacttggggtcaac
aatcatgaatttgggtggtcaatacctttggtaagaggcatcccccctgaactgatccat
ctggccgcagatgtgtatattggtaaccagacagacccattagccattcagaatgcagct
ctggacatatttggagacatgtttattcttcaaagtctgaaattttcggaggatctcaga
gattctggtgttccagtctacttttatgagttccagcatcggccaagtgcttttgataaa
atcaaacctgcttatgtaagagctgaccattcagctgaactcccattcatttgggggggc
ccttttatgacagatgaaggctccatgctggactccactgaggaagagaagcagctaagc
agagcaatgatgagatactgggccaattttattcgcacaggggaccccaatggagaaggg
ttgcccaactggcctctttttgaccaatcagagtcatacctagagttcaacttgacctta
aagatcagaagaaaactcaaagaagacaagatgggattttggagaaaattcattcatgaa
aaagtcaagccatatgttgaaggaaagaaagcacacgtcgaattgtga

DBGET integrated database retrieval system