KEGG   Monodelphis domestica (opossum): 100019689Help
Entry
100019689         CDS       T01031                                 

Gene name
PDIA2
Definition
protein disulfide isomerase family A, member 2
Orthology
K09581  
protein disulfide isomerase family A, member 2 [EC:5.3.4.1]
Organism
mdo  Monodelphis domestica (opossum)
Brite
Enzymes [BR:mdo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100019689 (PDIA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
6
AA seq 529 aa AA seqDB search
MRRYSLLFFVLTVWAWTLNGEGAGEEGVEAPEEATPEPPSDELLEEDDILVLTQHNFGRA
LQEHRYLLVEFYAPWCGHCRALAPEYAKAASLLKNESSELKLAKVDGPAEKELAEEFGVT
GYPALKFFKDGNRSQPVEFTGPREAEGIVRWLKRRLGPSATRLETEAEAAQFIDSQDIVI
VGFFKDLQDEDVAGFLAIAEDAVDLTFGLTDRPELFQKYDLSRDTVVLFKKFDEGRADFP
VDEELGLDQADLTHFLVVHSMHLVTEFNSQTSSKIFEARILNHLLLFINQTLSPHRELLK
GFQEAAPAFRGEILFVVVDVAGENDHVLQYFGMNATDAPTLRLINVETTKKYVPGAGGEI
TAASVSAFCQDVLSGKVKPHLRSQEIPADWDQKPVKVLVGKNFEEVAFDASKNVFVKFYA
PWCTHCKEMAQTWEDLAEKYKDREDIVIAELDSTANELEAFAIRGFPTLKYFPAGPDRKV
IEYKSSRDLETFSKFLDNGGVLPEPEPKEPEVPLPEAGANDSKDHKDEL
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgagacgctactcactcctgttctttgtgcttacggtgtgggcctggaccctaaatggg
gagggggcgggggaggagggagtcgaggctccagaagaggccactccggaacccccctct
gatgaacttctggaggaggacgacatcttggtcctcacccaacacaactttggtcgggct
ctccaagaacaccgctacctgctggtagagttctatgccccctggtgtgggcactgcagg
gctctggcccctgagtatgccaaggcagcgtccctgttgaagaatgaatcctcagaactg
aagctggccaaggtggatggcccagcggagaaggagctggcagaagagtttggcgtgact
gggtaccctgccctcaagttcttcaaagatgggaacagatcccaacctgtggagtttaca
ggcccacgggaggctgagggcatcgttcgttggctaaagcgacgtttaggtcccagtgcc
actcgcctggagactgaggctgaagctgcacaattcattgattcccaagacattgttatt
gttgggttcttcaaggacctccaggatgaagacgtggctgggtttttggccattgcagag
gatgctgttgatttgacctttggcctcactgaccgaccagagctctttcagaaatatgac
ctgagcagggacactgtggtcctcttcaagaagtttgatgaggggcgtgcagattttcca
gtggatgaggagctgggattggaccaagcagatctcacccatttcctcgttgtacatagc
atgcacttggtcacagaattcaacagtcagacctcctccaagatctttgaggccaggatc
ctcaaccacctcctgctcttcatcaaccagacacttagcccacaccgggagcttctgaaa
ggtttccaggaggctgccccggccttccggggagaaatcttgttcgtcgtggtggatgtg
gccggagagaatgaccacgttctgcagtacttcggcatgaatgccaccgatgcccccacg
cttcgccttatcaatgttgagaccaccaagaagtacgtgccgggcgctggaggggagatc
acggctgcctctgtctccgccttctgccaagacgtcctgagcggcaaagtcaagccgcat
ctgcggagtcaggagatcccggcagactgggaccagaaacctgtcaaggttcttgtaggg
aagaactttgaagaggttgcctttgacgcttccaagaacgtgttcgtgaagttctatgcg
ccctggtgtacgcactgcaaggagatggcccagacctgggaggacctggccgagaagtat
aaagaccgggaggacatcgtcattgcagagcttgactccacagccaatgagctggaggcc
ttcgccatccggggcttccccacccttaaatatttcccagccggacccgaccgtaaggtg
atcgagtataaaagttccagggacttggaaaccttctccaaattcttagacaacgggggt
gtcctgccagaaccagagccaaaggaacccgaggtcccccttccggaggctggagccaac
gacagcaaagaccacaaggatgaactgtag

DBGET integrated database retrieval system