KEGG   Monodelphis domestica (opossum): 100019775Help
Entry
100019775         CDS       T01031                                 

Gene name
DYRK1A
Definition
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase 1A
Orthology
K08825  
dual specificity tyrosine-phosphorylation-regulated kinase 1 [EC:2.7.12.1]
Organism
mdo  Monodelphis domestica (opossum)
Brite
Enzymes [BR:mdo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100019775 (DYRK1A)
Protein kinases [BR:mdo01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   100019775 (DYRK1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
4
AA seq 763 aa AA seqDB search
MHTGETSACKPSSVRLAPSFSFHAAGLQMAGQMPHSHQQYSDRRQPNISDQQVSALSYTD
QIQQPLTNQVMPDIVMLQRRMPQTFRDPATAPLRKLSVDLIKTYKHINEVYYAKKKRRHQ
QGQGDDSSHKKERKVYNDGYDDDNYDYIVKNGEKWMDRYEIDSLIGKGSFGQVVKAYDRV
EQEWVAIKIIKNKKAFLNQAQIEVRLLELMNKHDTEMKYYIVHLKRHFMFRNHLCLVFEM
LSYNLYDLLRNTNFRGVSLNLTRKFAQQMCTALLFLATPELSIIHCDLKPENILLCNPKR
SAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGMPYDLAIDMWSLGCILVEMHTGEPL
FSGANEVDQMNKIVEVLGIAPAHILDQAPKARKFFEKLPDGTWNLKKTKDGKREYKPPGT
RKLHNILGVETGGPGGRRAGESGHTVADYLKFKDLILRMLDYDPKTRIQPYYALQHSFFK
KTADEGTNTSNSVSTSPAMEQSQSSGTTSSTSSSSGGSSGTSNSGRARSDPTHQHRHSGG
HFTAAVQAMDCETHSPQVRQQFPAPLGWSGPEAPTQVTVETHPVQETTFHVAPQQNALHH
HHGNSSHHHHHHHHHHHHHGQQALGNRTRPRVYNSPTNSSSTQDSMEVGHSHHSMTSLSS
STTSSSTSSSSTGNQGNQAYQNRPVVANPLDFGQNGAMDVNLTVYSNPRQETGITGHPAY
QFSANTGPTHYMTEGHLAMRQGIDREESPMTGVCVQQSPVASS
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atgcatacaggagagacttcagcatgcaaaccttcatctgttcgccttgcaccatcattt
tcattccatgccgctggtcttcagatggctggacagatgccccattcacatcagcagtac
agtgaccgtcgtcagccaaacataagtgaccaacaggtttctgccttatcttatactgac
cagattcagcagcctctaactaaccaggtgatgcctgatattgtcatgttacagagacga
atgccccaaaccttccgtgatccagcaactgctcccctgaggaaactctctgttgacttg
atcaaaacatacaaacatattaatgaggtttactatgcaaaaaagaagcgaagacatcaa
cagggccaaggagatgattctagtcataaaaaggagcggaaagtttacaatgatggctac
gatgatgataactatgattatattgtaaaaaatggggaaaaatggatggatcgttatgaa
attgactctttaattggaaagggttcttttggacaggttgtaaaggcatatgatcgtgtg
gagcaggagtgggttgccattaaaattattaagaacaagaaggcttttttaaatcaagcc
cagattgaagtacgacttcttgagcttatgaacaaacatgacactgaaatgaaatattac
atagtgcatttgaaacgccactttatgttccgaaaccatctctgcttagtttttgaaatg
ttgtcttataatctttatgacttgttaaggaacacaaattttcgaggtgtctctttgaac
ctgacacgaaaatttgcacaacagatgtgcactgcactgcttttccttgcaactccagaa
cttagtatcattcactgtgacctcaaacctgagaatattcttctctgtaaccctaaacgc
agcgctatcaagattgttgactttggaagttcttgtcaactgggacagaggatataccag
tacatccagagtcgcttttatcgctctccagaggtactattgggaatgccttatgatctt
gctattgacatgtggtcccttgggtgtattttagttgaaatgcacactggagaacctctt
ttcagtggagccaatgaggtagatcagatgaataaaatagtggaagttctgggaatagca
cctgcacacattcttgaccaagcacccaaagcaagaaagttctttgagaagttgccggat
ggcacttggaacttaaagaagaccaaagatgggaaaagggagtataaaccgccaggaact
cgtaaacttcataatattcttggagtagaaacaggaggccccgggggacgccgtgctggg
gaatctggacatactgtggcggactacttgaagttcaaagacctcatcttaaggatgctt
gattatgaccctaagactagaatccaaccatattatgccctgcagcatagtttttttaag
aaaacagcagatgaaggtacaaatacgagtaacagtgtctccacaagtcctgccatggag
cagtcacagtcttcaggaaccacctctagtacatcttcaagctcaggtggatcttcaggg
acaagcaacagtggaagggcccggtcagatccaacacatcagcatcggcatagtggtggt
cattttacagctgctgtccaagcaatggactgtgaaacacacagtcctcaggtgcgccag
caatttccagctcctcttggttggtcaggccctgaagcgcctacacaagtcactgttgaa
acccacccagttcaagaaacaacgttccatgtagcccctcaacagaatgcattacatcat
catcatggaaacagctcccaccaccaccaccaccatcaccaccaccaccatcaccatgga
caacaagccttgggtaaccggaccaggccgagggtctacaattctccaacaaacagctct
tctacccaagattctatggaagttggccatagtcaccactccatgacatccctgtcttcc
tcaactacttcttcttctacatcttcctcctctactggtaaccaaggtaatcaagcctac
cagaatcgcccagtggtcgccaatcccttggactttggacagaatggagccatggatgtt
aatttaacagtctactccaatccccgccaggagactggcataactggacatccagcctac
caattttctgccaatacaggtcctacacattacatgactgaaggacatctggctatgagg
caaggaattgatagagaagaatctcctatgacgggagtttgtgttcaacaaagtcctgtg
gctagctcgtga

DBGET integrated database retrieval system